KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0735Help
Entry
NMB0735           CDS       T00027                                 

Gene name
ubiA
Definition
(RefSeq) 4-hydroxybenzoate octaprenyltransferase
  KO
K03179  
4-hydroxybenzoate polyprenyltransferase [EC:2.5.1.39]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Ubiquinone and other terpenoid-quinone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    NMB0735 (ubiA)
Enzymes [BR:nme01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.39  4-hydroxybenzoate polyprenyltransferase
     NMB0735 (ubiA)
Prenyltransferases [BR:nme01006]
 Compound prenylation
  4HB prenyltransferase
   NMB0735 (ubiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
766063..766953
Genome map
AA seq 296 aa AA seqDB search
MNPKSPLFLRLSDRLDVYLRLMRADKPIGTLLLLWPTYWALWLASDGIPDLAVLAAFTIG
TFLMRSAGCVINDFADRDFDGAVERTKNRPFAQGRVKKKEALLLTAFLCLLAALCLIPLN
HLTWLMSLPALFLALTYPFTKRFFPIPQLYLGLAFSFGIPMAFAAVAGNVPPQAWILFAA
NVLWTLAYDTVYAMADKEDDLKIGIKTSAVTFGRYDIAAVMLCHGGFTLLMAVLGAVIGA
AWAYWTAIPIVLLLQYRQYAAIKSRVRQICFETFLANNRIGWVWFTAIFAHTFFAK
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgaatcctaaatcccctttatttttacgcctgtccgaccgtttggatgtgtacctgcgc
ctgatgcgggcggacaagcccattgggacgctgcttttactgtggccgacctactgggca
ttgtggctggcttcagacggcattcccgatttggcggtattggcggcgtttacaatcggc
acgtttttaatgcgcagtgccggctgcgtcatcaacgactttgccgaccgcgattttgac
ggtgctgtcgagcgtacaaaaaaccgtccgttcgcacagggcagggtcaagaaaaaagaa
gcgctgctgctgacggcatttttgtgcctgcttgccgcattgtgcctgattccgctgaat
catctgacttggctgatgagcctgcccgcgctgtttcttgcgctgacttacccgtttacc
aaacgtttttttccgattccccaactctatctcgggcttgccttttccttcggtatcccg
atggcgtttgccgccgttgccggaaacgtgccgcctcaagcgtggatactctttgccgcc
aatgtgttatggactctggcgtatgacacggtttatgcaatggcggacaaagaagacgat
ttgaaaatcggcatcaaaacctccgccgtcacgttcgggcgttacgacatcgccgccgtt
atgctgtgtcacggaggctttaccctgctgatggcagtattgggtgcggttatcggtgcg
gcatgggcatattggacggcaatccccatcgtcctgctgctgcaataccgccaatatgcc
gccatcaaaagccgcgtccggcaaatctgttttgaaacgtttttggcaaacaacagaatt
ggttgggtgtggtttaccgccatttttgcccatacgtttttcgcgaaataa

DBGET integrated database retrieval system