KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0736Help
Entry
NMB0736           CDS       T00027                                 

Gene name
ptsN
Definition
(RefSeq) PTS system nitrogen regulatory protein IIA
  KO
K02806  
PTS system, nitrogen regulatory IIA component [EC:2.7.1.-]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:nme00001]
 Environmental Information Processing
  Membrane transport
   02060 Phosphotransferase system (PTS)
    NMB0736 (ptsN)
Enzymes [BR:nme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.-  
     NMB0736 (ptsN)
Transporters [BR:nme02000]
 Phosphotransferase System (PTS)
  Enzyme II [TC:4.A]
   Nitrogen regulatory II component
    NMB0736 (ptsN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
767138..767587
Genome map
AA seq 149 aa AA seqDB search
MSLIGEILPLSHIVLDMEVGSKKRLFEEAGLLLERESSLSHADVFECLFAREKLGSTGLG
QGVAIPHGRHAGVKQATGAFIRTREPVGFDAPDGKPVSLIFILLVPENATGEHLEVLSKL
AGKFSQKSIRESLMTVSSAEEVRAILTEE
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atgagccttatcggcgaaattttgcctttgtcccatattgttttggatatggaggtaggc
agtaaaaaaaggctgtttgaggaagcaggcctgcttttggaacgcgaatcctcattgtcc
catgctgatgttttcgaatgtctttttgcccgtgaaaaactcggttcgaccggtttgggg
cagggcgttgccatcccgcacggccgtcatgccggcgtgaagcaggcgacgggcgcgttc
atccgcacgcgcgaacccgtcggatttgacgcaccggacggcaagccggtttccctgatt
tttatcttgctggttccggaaaacgcaaccggcgagcatttggaagtcttatccaaactg
gccggcaagttttcccaaaaaagcatcagagaatcgctgatgacggtttcctctgcggaa
gaagtccgtgccatcctgactgaagaataa

DBGET integrated database retrieval system