KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0749Help
Entry
NMB0749           CDS       T00027                                 

Definition
(RefSeq) penicillin-binding protein 4
  KO
K07262  
serine-type D-Ala-D-Ala endopeptidase (penicillin-binding protein 7) [EC:3.4.21.-]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Brite
Enzymes [BR:nme01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     NMB0749
Peptidases [BR:nme01002]
 Serine Peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   NMB0749
Peptidoglycan biosynthesis and degradation proteins [BR:nme01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   NMB0749
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
complement(779702..780640)
Genome map
AA seq 312 aa AA seqDB search
MSIHTLKRLPSSLLLGLCLSLPSAHLFADNDILGQFLEQNMLTSSDPIEIFAESTIHPTN
TQAITGGLILSSQSALVVNNKTGQILYQKNADRIMPIASISKLMSAMVVLDANLDMNETV
TITPDEIDRIKGTGSRLAIGTALTRKKLLHLSLMSSENRATHALGRTYPGGMGAFVAAMN
RKAQSLGMYGSRFYEPTGLNFQNVSTAKDLSLMVNAAAQYPQIRTNSTSNYASVQTKNGQ
QNYKNSNALVREGMWNIELQKTGYIREAGRSMVVKANIQNQPVTIVLLNSPTSATRVNDA
RKIESWMLQQRS
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgtccatccatactctgaaacgcctgccctcatcgctgctgctcggtctctgcctttcc
ctgccgtcagcccacctttttgccgacaacgacattttagggcaatttttagaacagaac
atgcttacctcctccgatccgatagaaatattcgccgaaagcacgatacaccccaccaac
acccaagccattacaggcggtctgattctctcctcacagtctgccctggtcgtcaacaac
aaaaccggacagatactgtatcagaaaaacgccgacaggattatgcccatcgcctccatt
tccaaactgatgagcgcgatggtcgttttggatgcaaacttggacatgaacgaaaccgtt
accattacgcccgacgaaatcgaccgcatcaaagggaccggcagccgtcttgccataggt
acggcacttacacgcaaaaaactgctgcacctgagcctgatgagcagcgaaaaccgcgcc
acccatgcattgggcagaacctaccccggcggcatgggcgcatttgtcgccgccatgaac
cgcaaagcccaaagcctcggtatgtacggcagccgcttttacgaaccgaccggactcaac
ttccaaaacgtttctaccgccaaagacctgagccttatggtcaacgccgccgcccaatat
ccgcaaatccgcaccaactcgacttccaactacgcctcggtacagaccaaaaacgggcag
cagaactacaaaaactccaatgccctggtcagagaaggcatgtggaacatcgaattgcag
aaaaccggctacatacgcgaagcaggcaggtctatggttgtcaaagccaacattcaaaac
caacccgttaccatcgtattgctgaactcgcccacatccgccacacgcgtcaacgacgcc
cgcaaaatcgaatcgtggatgctgcagcaacgctcctga

DBGET integrated database retrieval system