KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0750Help
Entry
NMB0750           CDS       T00027                                 

Gene name
bcp
Definition
(RefSeq) bacterioferritin comigratory protein
  KO
K03564  
peroxiredoxin Q/BCP [EC:1.11.1.15]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Brite
Enzymes [BR:nme01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.15  peroxiredoxin
     NMB0750 (bcp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
780961..781401
Genome map
AA seq 146 aa AA seqDB search
MDVKYEFTLPSSSGADFHSAEHLPLVVYFYPKDSTLGCTTEGLDFNARLEQFEALGYTVV
GISRDGVKAHQNFCAKQGFRFELLSDKDETVCRLFDVIKLKKLYGKESLGIERSTFVLNK
DGEIAHEWRKVKVAGHAQEVLETLSR
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atggatgtgaaatatgaatttaccctgccttcgagcagcggtgcggattttcattcggca
gaacatctgcctttggtcgtgtatttttatccgaaagacagtacgctgggctgtacgacg
gaaggcttggatttcaatgcgcgtttggaacagtttgaggcattgggttataccgtggtc
ggtatttcccgcgacggcgtaaaggcgcatcagaatttttgcgccaagcagggtttccgg
ttcgagctgttgagcgacaaggatgaaacagtgtgccgcctgtttgatgtcatcaaattg
aagaaactgtacgggaaagagtcgttaggtatcgagcgcagtacgttcgtcttgaataag
gatggagaaatcgcccatgaatggcggaaagtcaaagtggcgggtcacgcgcaggaagta
ttggaaacgctttcccgataa

DBGET integrated database retrieval system