KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0756Help
Entry
NMB0756           CDS       T00027                                 

Definition
(RefSeq) dTDP-L-rhamnose synthase
  KO
K00067  
dTDP-4-dehydrorhamnose reductase [EC:1.1.1.133]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Biosynthesis of antibiotics
Module
dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    NMB0756
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    NMB0756
Enzymes [BR:nme01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.133  dTDP-4-dehydrorhamnose reductase
     NMB0756
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(783516..784436)
Genome map
AA seq 306 aa AA seqDB search
MRILLTGSKSQLARCLRDRLPEDWETIATDSASLDITDADAVCNMVKSFQPDAIVNTAAY
TAVDKAEGDAAAAFAVNASAVYNLALAAHRAHARFIHISTDYVFDGKGKRPYQESDFTNP
SNVYGQSKTAGELLALSANPDSLILRTSWLFSEYGDNFIRTMLNLARERSPLSAVHNQIG
CPTYAGDLSATIIRLLQHSNPVRGIYHYAGSKSVSWYEFAQHIFQAASQQQTSFPVPELT
AVSDKEYPTAAPRPAYSILDCRKIENDFGIKPSDWQKALHRSFPSCSDAARPSVSAVKHR
LGGFLI
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgagaatcctattgacaggctcgaaaagccaactggcacgctgcctgcgcgaccgtctt
ccggaagactgggaaaccattgcgacggattccgcatccctagacattaccgatgccgat
gccgtctgcaacatggtcaaaagtttccaacccgacgccattgtcaacacggctgcctat
actgccgtcgacaaggcggaaggcgatgcggcagcggcatttgccgtcaatgcttccgcc
gtttacaaccttgccttggcagcacatcgcgcccatgcccgattcatccacatctcaacc
gactatgtctttgacggtaaagggaaaagaccctatcaggaaagcgactttaccaatcct
tccaatgtatacggacaatccaaaaccgcaggcgagctgctcgcactgtctgccaatccc
gacagccttatcctgcggacttcttggctgtttagcgaatacggggacaactttatccgc
acgatgctgaaccttgcgcgggaacgttccccgctgtccgccgtccacaaccaaatcggc
tgcccgacctatgccggcgacttgtccgccaccatcatccgcctgttgcagcactccaat
cccgttcgcggcatttaccactacgccggcagcaaatccgtatcctggtacgaatttgcc
caacatattttccaagcggcatcgcaacagcagacatccttccccgttcccgaattgact
gccgtttcagacaaggaatatccgaccgccgcccccaggcccgcatacagcattttggac
tgccgcaaaatcgaaaacgacttcggcatcaaaccgtcagactggcaaaaagccttgcac
aggtcgtttccaagctgctctgatgccgcccgcccctctgtttccgccgtcaagcaccgc
cttggcggttttcttatatag

DBGET integrated database retrieval system