KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0760Help
Entry
NMB0760           CDS       T00027                                 

Gene name
dapF
Definition
(RefSeq) diaminopimelate epimerase
  KO
K01778  diaminopimelate epimerase [EC:5.1.1.7]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00300  Lysine biosynthesis
nme01100  Metabolic pathways
nme01110  Biosynthesis of secondary metabolites
nme01120  Microbial metabolism in diverse environments
nme01130  Biosynthesis of antibiotics
nme01230  Biosynthesis of amino acids
Module
nme_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    NMB0760 (dapF)
Enzymes [BR:nme01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.7  diaminopimelate epimerase
     NMB0760 (dapF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAP_epimerase
Motif
Other DBs
NCBI-GeneID: 902875
NCBI-ProteinID: NP_273802
UniProt: Q9K060
Position
789044..789895
Genome map
AA seq 283 aa AA seqDB search
MNTLKFTKMHGLGNDFMVIDAVSQDFTPEDAPIAEWADRFRGVGFDQLLVVGRSETEGVD
FRYRIFNADGSEVGQCGNGARCFARFVADKGLTDKKEICVETANGVIFPKLSDNGMVTVN
MGKPKFMPSEIPFVPESGEGDDACIYGVHLESGIQPVSCVNMGNPHAVIVVDDVECAPVR
ETGSLIEPHRQFPERVNVGFMQVVGRTAIRLRVFERGVGETQACGTGACAAVVAGIRLGL
LDEGKTVEVVLPGGTLYIEWACGGDVMMTGPAEAVFEGELAYS
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgaacactttgaaatttaccaaaatgcacggtttgggcaacgattttatggtgattgac
gcggtcagtcaggattttacccccgaggacgcgccgattgcggaatgggcggaccgcttc
cggggcgtgggcttcgaccagcttttggtggtcgggcgttcggaaaccgaaggcgtggat
ttccgttaccgtattttcaatgccgacggcagcgaggtcgggcaatgcggcaacggagcg
cgttgttttgcccgttttgttgcagacaagggtttgaccgataagaaagaaatttgtgtt
gaaacggcaaatggcgttatttttccgaaattgtccgataacggtatggttacggtcaat
atgggcaaaccgaagtttatgccgtctgaaataccgtttgtccccgaatcgggcgagggg
gatgatgcctgtatttacggggtgcatctcgaatccggcattcagcctgtcagctgcgtc
aatatgggcaacccccatgcggtgattgtggtcgatgacgtggaatgcgcgccggtgcgc
gaaaccggttcgcttatcgaaccgcacaggcagtttcccgaacgcgtcaatgtcggcttt
atgcaggttgtcggccgaaccgcgattcgtttgcgcgtgttcgagcgcggcgtgggcgaa
acccaagcttgcggtacgggcgcgtgtgcggctgtggtggcgggtatccgtctggggctg
ttggatgaagggaaaacggtagaggtggttttgccgggcgggactttatatatcgaatgg
gcctgcggcggcgatgtgatgatgaccggccctgcggaagcggtgtttgaaggtgagttg
gcgtattcatga

DBGET integrated database retrieval system