KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0760Help
Entry
NMB0760           CDS       T00027                                 

Gene name
dapF
Definition
(RefSeq) diaminopimelate epimerase
  KO
K01778  
diaminopimelate epimerase [EC:5.1.1.7]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Lysine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NMB0760 (dapF)
  Amino acid metabolism
   00300 Lysine biosynthesis
    NMB0760 (dapF)
Enzymes [BR:nme01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.7  diaminopimelate epimerase
     NMB0760 (dapF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
789044..789895
Genome map
AA seq 283 aa AA seqDB search
MNTLKFTKMHGLGNDFMVIDAVSQDFTPEDAPIAEWADRFRGVGFDQLLVVGRSETEGVD
FRYRIFNADGSEVGQCGNGARCFARFVADKGLTDKKEICVETANGVIFPKLSDNGMVTVN
MGKPKFMPSEIPFVPESGEGDDACIYGVHLESGIQPVSCVNMGNPHAVIVVDDVECAPVR
ETGSLIEPHRQFPERVNVGFMQVVGRTAIRLRVFERGVGETQACGTGACAAVVAGIRLGL
LDEGKTVEVVLPGGTLYIEWACGGDVMMTGPAEAVFEGELAYS
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgaacactttgaaatttaccaaaatgcacggtttgggcaacgattttatggtgattgac
gcggtcagtcaggattttacccccgaggacgcgccgattgcggaatgggcggaccgcttc
cggggcgtgggcttcgaccagcttttggtggtcgggcgttcggaaaccgaaggcgtggat
ttccgttaccgtattttcaatgccgacggcagcgaggtcgggcaatgcggcaacggagcg
cgttgttttgcccgttttgttgcagacaagggtttgaccgataagaaagaaatttgtgtt
gaaacggcaaatggcgttatttttccgaaattgtccgataacggtatggttacggtcaat
atgggcaaaccgaagtttatgccgtctgaaataccgtttgtccccgaatcgggcgagggg
gatgatgcctgtatttacggggtgcatctcgaatccggcattcagcctgtcagctgcgtc
aatatgggcaacccccatgcggtgattgtggtcgatgacgtggaatgcgcgccggtgcgc
gaaaccggttcgcttatcgaaccgcacaggcagtttcccgaacgcgtcaatgtcggcttt
atgcaggttgtcggccgaaccgcgattcgtttgcgcgtgttcgagcgcggcgtgggcgaa
acccaagcttgcggtacgggcgcgtgtgcggctgtggtggcgggtatccgtctggggctg
ttggatgaagggaaaacggtagaggtggttttgccgggcgggactttatatatcgaatgg
gcctgcggcggcgatgtgatgatgaccggccctgcggaagcggtgtttgaaggtgagttg
gcgtattcatga

DBGET integrated database retrieval system