KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0763Help
Entry
NMB0763           CDS       T00027                                 

Gene name
cysK
Definition
(RefSeq) cysteine synthase
  KO
K01738  
cysteine synthase A [EC:2.5.1.47]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Cysteine and methionine metabolism
Sulfur metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Cysteine biosynthesis, serine => cysteine
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    NMB0763 (cysK)
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    NMB0763 (cysK)
Enzymes [BR:nme01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.47  cysteine synthase
     NMB0763 (cysK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
790691..791623
Genome map
AA seq 310 aa AA seqDB search
MKIANSITELIGNTPLVKLNRLTEGLKAEVAVKLEFFNPGSSVKDRIAEAMIEGAEKAGK
INKNTVIVEATSGNTGVGLAMVCAARGYKLAITMPESMSKERKMLLRAFGAELILTPAAE
GMAGAIAKAKSLVDAHPDTYFMPRQFDNEANPEVHRKTTAEEIWRDTDGKVDVFVAGVGT
GGTITGVGEVLKKYKPEVKVVAVEPEASPVLSGGEKGPHPIQGIGAGFIPTVLNTKIYDS
ITKVSNEAAFETARAIAEKEGILVGISSGAAVWSALQLAKQPENEGKLIVVLLPSYGERY
LSTPLFADLA
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattgcaaacagcattaccgaactaatcggcaacacgcctttggtcaaactgaac
cgtctgaccgaaggtttgaaggcagaggttgccgtgaaactggaatttttcaatccgggc
agcagcgtcaaagaccgcattgccgaagcaatgattgagggtgccgaaaaagcgggcaaa
atcaacaaaaacaccgtcattgtcgaagcaaccagcggcaatacgggtgtcggtttggca
atggtatgtgccgcacgcggctacaagctggcgattaccatgccggaaagcatgagtaag
gagcgcaaaatgctgttgcgcgcgtttggtgcggagctgattctgacccctgccgccgaa
ggtatggcgggcgcgattgccaaagcgaaatccttggtggacgcgcatcccgacacttat
tttatgccgcgccagttcgacaatgaggcaaaccccgaagtccaccgcaaaacaaccgcc
gaggaaatttggcgggatacggacggcaaagtcgatgtcttcgttgccggcgtcggcacg
ggcggtacgattaccggcgtgggcgaagtgttgaaaaaatacaaacccgaagttaaagtg
gttgccgtcgagcctgaagcttcacccgtattgagcggcggcgaaaaaggcccgcacccg
attcaaggcatcggcgcaggctttattccgaccgttttgaataccaaaatttacgacagc
attaccaaagtgtcgaacgaagcggcttttgaaaccgcccgcgcaatagcggaaaaagaa
ggcattttggtgggtatttcttccggtgcggcggtttggagtgcgttgcagcttgccaaa
cagcctgaaaacgaaggcaagctgatagtcgtgctgctgccttcttatggcgaacgctat
ctctctacgccactttttgcagatttggcataa

DBGET integrated database retrieval system