KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0767Help
Entry
NMB0767           CDS       T00027                                 

Gene name
pfs
Definition
(RefSeq) 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase
  KO
K01243  
adenosylhomocysteine nucleosidase [EC:3.2.2.9]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NMB0767 (pfs)
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    NMB0767 (pfs)
Enzymes [BR:nme01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.9  adenosylhomocysteine nucleosidase
     NMB0767 (pfs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(796246..796947)
Genome map
AA seq 233 aa AA seqDB search
MSLKTVAVIGAMEQEIELLREMMENVKAVSFGRFSAYEGELAGKRMVLALSGIGKVNAAV
ATAWIIREFAADCVINTGSAGGLGKGLKVGDVVIGTETAHHDVDVTAFGYAWGQVPQLPA
RFASDGILIEAAKRAARTFEGAAVEQGLIVSGDRFVHSSEGVAEIRKHFPEVKAVEMEAA
AIAQTCHQLETPFVIIRAVSDSADEKADISFDEFLKTAAANSAKMVAEIVKSL
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgtctttgaaaacagtagccgttatcggcgcaatggaacaagaaatcgagcttttgcgc
gagatgatggaaaatgtcaaagccgtctctttcggcagattttccgcctatgaaggcgaa
ttggcgggaaaacgcatggtgcttgcattgagcggcatcggcaaggtcaacgcggcggtt
gcaacggcttggattatccgtgaattcgcagcggactgcgtcatcaacaccggcagcgcg
ggcggtttgggcaagggtttgaaagtcggcgacgtagtcatcggcacggaaaccgcacac
cacgatgtcgacgtaaccgcattcggctatgcctggggacaagtgccgcaactgccggca
aggtttgcttcagacggcattttgattgaggcggcaaaacgggcggcgcggacgtttgaa
ggcgcggcggtagaacaagggctgattgtcagcggcgaccgctttgtccacagcagcgaa
ggcgtggcggaaatccgcaagcacttccccgaagtcaaagcagtggaaatggaagcggcg
gcaatcgcccaaacctgtcatcagttggaaacgcctttcgtcatcatccgcgcggtttcc
gattcggcagatgaaaaagcagacatcagctttgacgagttcttgaaaacggcggcggca
aattccgcaaaaatggtggcagaaatcgtcaaatctttataa

DBGET integrated database retrieval system