KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0781Help
Entry
NMB0781           CDS       T00027                                 

Gene name
hemE
Definition
(RefSeq) uroporphyrinogen decarboxylase
  KO
K01599  
uroporphyrinogen decarboxylase [EC:4.1.1.37]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    NMB0781 (hemE)
Enzymes [BR:nme01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.37  uroporphyrinogen decarboxylase
     NMB0781 (hemE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
806770..807834
Genome map
AA seq 354 aa AA seqDB search
MISLKNDTFLRALLKQPVEYTPIWMMRQAGRYLPEYKATRAKAGSFLDLCKNTELATEVT
IQPLERFDLDAAILFSDILTVPDAMGLGLYFAEGEGPKFKRALQHEADIAKLHVPDMEKL
QYVFDAVTSIRKALDGRVPLIGFSGSPFTLACYMVEGGGSKEFRTIKTMMYSRPDLLHKI
LDTNAQAVTAYLNAQIDAGAQAVQIFDTWGGVLSDAAFKEFSLKYIRQIVAGLKRESEGR
RVPVIVFAKGGGLWLESMAQIGADALGLDWTCNIGEARRRVGKQVALQGNFDPFALFGTP
ESIRTEVARILADYGHGSGHVFNLGHGINQHADPEHAKILVDTVHELSRQYHGG
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgatctctttgaaaaacgacactttcctccgcgccctgctcaaacaacctgtcgaatac
acgccgatttggatgatgcgccaggcggggcgttatctgcccgaatacaaagccacacgc
gcgaaagcgggcagcttcctcgatttgtgcaaaaacaccgaattggcgaccgaagttacc
atccaacctttggaacgtttcgatttggacgcggcgattttgttttccgacatcctgacc
gtccctgacgcaatgggcttgggactgtattttgccgaaggcgaaggcccgaaattcaaa
cgcgccctgcaacacgaggccgacatcgccaagctgcacgttcccgatatggaaaaactg
caatacgttttcgacgcggtaacttccatccgtaaagcattggacggccgcgtaccgctc
atcggcttctccggcagtccgttcacgctcgcctgttatatggtcgaaggcggcggcagc
aaagaattccgcaccatcaaaaccatgatgtactcgcgccccgatttgctgcacaaaatc
ctcgataccaacgcccaagccgttaccgcctacctcaacgcccaaatcgacgcgggcgcg
caggcggtgcagattttcgacacttggggcggcgtgttgagcgatgcggcgtttaaagaa
ttcagcctcaaatacatccgccagatcgtcgccggactcaaacgcgaaagcgaaggccgc
cgcgtgcctgttatcgtatttgccaaaggcggcgggctgtggctggaaagtatggcccaa
atcggcgcagacgcattgggcttggactggacgtgtaacatcggcgaagcacgccgccgc
gtcggcaagcaagtcgccctgcaaggcaacttcgacccgttcgccctcttcggtacgccg
gaatccatccgcaccgaggtcgcacgtatcctagccgactacggacacggcagcggccat
gtcttcaacctcggacacggcatcaaccaacacgccgaccccgaacacgccaaaatctta
gtcgataccgtacacgagctgtctcggcagtatcacggcgggtaa

DBGET integrated database retrieval system