KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0789Help
Entry
NMB0789           CDS       T00027                                 

Definition
(RefSeq) amino acid ABC transporter ATP-binding protein
  KO
K10010  
cystine transport system ATP-binding protein [EC:3.6.3.-]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
ABC transporters
Module
Cystine transport system
Brite
KEGG Orthology (KO) [BR:nme00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    NMB0789
Enzymes [BR:nme01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.-  
     NMB0789
Transporters [BR:nme02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Cystine transporter [MD:M00234] [OT]
    NMB0789
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
817224..817979
Genome map
AA seq 251 aa AA seqDB search
MIKIRNIHKTFGENTILRGIDLDVCKGQVVVILGPSGSGKTTFLRCLNALEMPEDGQIEF
DNERPLKIDFSKKPSKHDILALRRKSGMVFQQYNLFPHKTALENVMEGPVAVQGKPAAQA
REEALKLLEKVGLGDKVDLYPYQLSGGQQQRVGIARALAIQPELMLFDEPTSALDPELVQ
DVLDTMKELAQEGWTMVVVTHEIKFALEVATTVVVMDGGVIVEQGSPQDLFDHPKHERTR
RFLSQIQSTKI
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaatccgcaatatccataagacctttggcgaaaacactattttgcgcggcatc
gatttggatgtgtgcaaagggcaggtggtcgtcatcctcgggccttccggctcaggcaaa
acgacgtttctgcgatgcctaaacgcgttggaaatgcccgaagacggacaaatcgagttc
gacaacgagcgaccgctgaaaatcgatttttctaaaaaaccaagcaaacacgatattttg
gcactgcgccgcaaatcaggcatggtgtttcaacaatacaacctctttccgcacaaaacc
gccttggaaaacgtaatggaaggaccggttgccgtacagggcaagcctgccgcccaagcg
cgcgaagaggctctgaaactgctggaaaaagtcggcttgggcgacaaagtggatttgtat
ccctaccagctttccggcggtcagcagcagcgcgtcggcattgcccgcgcattggcgatt
cagcctgaactgatgctgtttgacgaaccgacttccgcgctcgatcctgaattggtgcaa
gatgttttggataccatgaaggaattggcgcaagaaggctggaccatggttgtcgttacg
catgaaatcaagttcgccttagaagtggcaaccaccgtcgtcgtgatggacggcggcgtt
attgtcgaacaaggcagcccgcaagatttgttcgaccaccccaaacacgaacggacgcgg
agatttttaagccaaatccaatctaccaagatttga

DBGET integrated database retrieval system