KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0790Help
Entry
NMB0790           CDS       T00027                                 

Gene name
pgm
Definition
(RefSeq) phosphoglucomutase
  KO
K01835  
phosphoglucomutase [EC:5.4.2.2]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:nme00001]
   00010 Glycolysis / Gluconeogenesis
    NMB0790 (pgm)
   00030 Pentose phosphate pathway
    NMB0790 (pgm)
   00052 Galactose metabolism
    NMB0790 (pgm)
   00500 Starch and sucrose metabolism
    NMB0790 (pgm)
   00520 Amino sugar and nucleotide sugar metabolism
    NMB0790 (pgm)
  Nucleotide metabolism
   00230 Purine metabolism
    NMB0790 (pgm)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    NMB0790 (pgm)
Enzymes [BR:nme01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     NMB0790 (pgm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(817999..819381)
Genome map
AA seq 460 aa AA seqDB search
MASIARDIFKAYDIRGIVGKTLTDEAAYLIGKAIAAKAAEKGITRIALGRDGRLSGPELM
EHIRRGFTDSGINVLNVGMVATPMLYFAAVNECGGSGVMITGSHNPPDYNGFKMMLGGDT
LAGEAIQELLSIIEKDGFAAAGKQGSVTEKDISGEYLKHITGHIRLKRPMNIAIDAGNGV
GGAFAGKLYKGLGNKVTELFCDVDGTFPNHHPDPSKPKNLQDLIAALKNGDAEIGLAFDG
DADRLGVVTKDGNIIYPDRQLMLFAQDVLNRNPGAKVIFDVKSTRLLAPWIKEHGGKAIM
EKTGHSFIKSAMKETGAPVAGEMSGHIFFKERWFGFDDGLYAGARLLEILSASDNPSEVL
NNLPQSISTPELNIALPEGSNGHQVIDELAAKAEFEGATEIITIDGLRVEFPDGFGLMRA
SNTTPILVLRFEADTQEAIERIQNQFKAVIESNPNLIWPL
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atggcaagcatcgcccgcgacatcttcaaagcctacgacatccggggtattgtcggcaaa
accctgaccgacgaagccgcctaccttatcggcaaagccatcgccgccaaagccgccgaa
aaaggcattacccgcatcgcgctcggacgcgacggacgcttgagcggtcccgaactgatg
gaacacatccggcgcggctttaccgacagcggcatcaatgtcctcaatgtcggtatggtt
gccactcctatgctctacttcgccgccgtcaacgaatgcggcggcagcggcgtgatgatt
accggcagccacaatccgcccgattacaacggctttaaaatgatgctcggcggcgacacg
cttgccggcgaagccatccaagaacttttgtccatcattgaaaaagacggttttgctgcc
gccggcaaacaaggcagcgtcaccgaaaaagacatctccggcgaatacctcaaacacatt
accggacacatcaggctcaaacgcccgatgaacatcgccattgacgcgggcaacggcgtg
ggcggcgcgtttgccggcaaactctacaaaggcttgggcaacaaagtaaccgagcttttc
tgcgacgtggacggcactttccccaaccaccatcccgacccatccaaaccgaaaaacctg
caagatttgattgccgcgctgaaaaacggtgatgccgaaatcggcttggcgtttgacggc
gatgccgaccgcttgggtgtggttaccaaagacggcaacattatttatcccgaccgccaa
ctgatgctgttcgcccaagacgttttgaaccgcaatcccggcgcgaaagtcattttcgac
gtgaagtccacccgcctgcttgcgccttggattaaagaacacggcggcaaagccataatg
gaaaaaaccggccacagctttatcaaatccgccatgaaagaaaccggcgcgccggttgcc
ggcgaaatgagcggacacatcttcttcaaagaacgctggttcggcttcgacgacggtctg
tacgccggcgcacgcctcttggaaatcctgtctgcctccgataatccgtccgaagtgtta
aacaacctgccgcaaagcatttccacgcccgaactcaacatcgccctgcccgaaggcagc
aacggccatcaggttatcgacgaactcgccgccaaagccgaatttgaaggcgcaaccgaa
atcatcaccatcgacggtctgcgcgttgaatttcccgacggcttcggtctgatgcgtgct
tccaataccacgccgattctggtgttgcgttttgaggcggatacgcaagaagccatcgag
cggattcaaaaccaattcaaagccgtcatcgaaagcaatccgaatctaatctggcctctg
taa

DBGET integrated database retrieval system