KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0790Help
Entry
NMB0790           CDS       T00027                                 

Gene name
pgm
Definition
(RefSeq) phosphoglucomutase
  KO
K01835  phosphoglucomutase [EC:5.4.2.2]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00010  Glycolysis / Gluconeogenesis
nme00030  Pentose phosphate pathway
nme00052  Galactose metabolism
nme00230  Purine metabolism
nme00500  Starch and sucrose metabolism
nme00520  Amino sugar and nucleotide sugar metabolism
nme00521  Streptomycin biosynthesis
nme01100  Metabolic pathways
nme01110  Biosynthesis of secondary metabolites
nme01120  Microbial metabolism in diverse environments
nme01130  Biosynthesis of antibiotics
Module
nme_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NMB0790 (pgm)
   00030 Pentose phosphate pathway
    NMB0790 (pgm)
   00052 Galactose metabolism
    NMB0790 (pgm)
   00500 Starch and sucrose metabolism
    NMB0790 (pgm)
   00520 Amino sugar and nucleotide sugar metabolism
    NMB0790 (pgm)
  Nucleotide metabolism
   00230 Purine metabolism
    NMB0790 (pgm)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    NMB0790 (pgm)
Enzymes [BR:nme01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     NMB0790 (pgm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV Ribosomal_L18p DUF2218
Motif
Other DBs
NCBI-GeneID: 902905
NCBI-ProteinID: NP_273832
UniProt: P40391
Position
complement(817999..819381)
Genome map
AA seq 460 aa AA seqDB search
MASIARDIFKAYDIRGIVGKTLTDEAAYLIGKAIAAKAAEKGITRIALGRDGRLSGPELM
EHIRRGFTDSGINVLNVGMVATPMLYFAAVNECGGSGVMITGSHNPPDYNGFKMMLGGDT
LAGEAIQELLSIIEKDGFAAAGKQGSVTEKDISGEYLKHITGHIRLKRPMNIAIDAGNGV
GGAFAGKLYKGLGNKVTELFCDVDGTFPNHHPDPSKPKNLQDLIAALKNGDAEIGLAFDG
DADRLGVVTKDGNIIYPDRQLMLFAQDVLNRNPGAKVIFDVKSTRLLAPWIKEHGGKAIM
EKTGHSFIKSAMKETGAPVAGEMSGHIFFKERWFGFDDGLYAGARLLEILSASDNPSEVL
NNLPQSISTPELNIALPEGSNGHQVIDELAAKAEFEGATEIITIDGLRVEFPDGFGLMRA
SNTTPILVLRFEADTQEAIERIQNQFKAVIESNPNLIWPL
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atggcaagcatcgcccgcgacatcttcaaagcctacgacatccggggtattgtcggcaaa
accctgaccgacgaagccgcctaccttatcggcaaagccatcgccgccaaagccgccgaa
aaaggcattacccgcatcgcgctcggacgcgacggacgcttgagcggtcccgaactgatg
gaacacatccggcgcggctttaccgacagcggcatcaatgtcctcaatgtcggtatggtt
gccactcctatgctctacttcgccgccgtcaacgaatgcggcggcagcggcgtgatgatt
accggcagccacaatccgcccgattacaacggctttaaaatgatgctcggcggcgacacg
cttgccggcgaagccatccaagaacttttgtccatcattgaaaaagacggttttgctgcc
gccggcaaacaaggcagcgtcaccgaaaaagacatctccggcgaatacctcaaacacatt
accggacacatcaggctcaaacgcccgatgaacatcgccattgacgcgggcaacggcgtg
ggcggcgcgtttgccggcaaactctacaaaggcttgggcaacaaagtaaccgagcttttc
tgcgacgtggacggcactttccccaaccaccatcccgacccatccaaaccgaaaaacctg
caagatttgattgccgcgctgaaaaacggtgatgccgaaatcggcttggcgtttgacggc
gatgccgaccgcttgggtgtggttaccaaagacggcaacattatttatcccgaccgccaa
ctgatgctgttcgcccaagacgttttgaaccgcaatcccggcgcgaaagtcattttcgac
gtgaagtccacccgcctgcttgcgccttggattaaagaacacggcggcaaagccataatg
gaaaaaaccggccacagctttatcaaatccgccatgaaagaaaccggcgcgccggttgcc
ggcgaaatgagcggacacatcttcttcaaagaacgctggttcggcttcgacgacggtctg
tacgccggcgcacgcctcttggaaatcctgtctgcctccgataatccgtccgaagtgtta
aacaacctgccgcaaagcatttccacgcccgaactcaacatcgccctgcccgaaggcagc
aacggccatcaggttatcgacgaactcgccgccaaagccgaatttgaaggcgcaaccgaa
atcatcaccatcgacggtctgcgcgttgaatttcccgacggcttcggtctgatgcgtgct
tccaataccacgccgattctggtgttgcgttttgaggcggatacgcaagaagccatcgag
cggattcaaaaccaattcaaagccgtcatcgaaagcaatccgaatctaatctggcctctg
taa

DBGET integrated database retrieval system