KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0792Help
Entry
NMB0792           CDS       T00027                                 

Definition
(RefSeq) transporter
  KO
K14445  
solute carrier family 13 (sodium-dependent dicarboxylate transporter), member 2/3/5
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Brite
Transporters [BR:nme02000]
 Solute Carrier Family (SLC)
  SLC13: Human Na+-sulfate/carboxylate cotransporter
   NMB0792
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
complement(820176..821591)
Genome map
AA seq 471 aa AA seqDB search
MNLHAKDKTQHPENVELLSAQKPITDFKGLLTTIISAVVCFGIYHILPYSPDANKGIALL
IFVAALWFTEAVHITVTALMVPILAVVLGFPDMDIKKAMADFSNPIIYIFFGGFALATAL
HMQRLDRKIAVSLLRLSRGNMKVAVLMLFLVTAFLSMWISNTATAAMMLPLAMGMLSHLD
QEKEHKTYVFLLLGIAYCASIGGLGTLVGSPPNLIAAKALNLDFVGWMKLGLPMMLLILP
LMLLSLYVILKPNLNERVEIKAESIPWTLHRVIALLIFLATAAAWIFSSKIKTAFGISNP
DTVIALSAAVAVVVFGVAQWKEVARNTDWGVLMLFGGGISLSTLLKTSGASEALGQQVAA
TFSGAPAFLVILIVAAFIIFLTEFTSNTASAALLVPIFSGIAMQMGLPEQVLVFVIGIGA
SCAFMLPVATPPNAIVFGTGLIKQREMMNVGILLNILCVVLVALWAYAVLM
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgaacctgcatgcaaaggacaaaacccagcatcccgaaaacgtcgagctgctcagtgcg
cagaagccgattaccgactttaagggcctgctgaccaccattatttccgccgtcgtctgt
ttcggcatttaccacatcctgccttacagccccgatgccaataaaggtatcgcgctgctg
attttcgttgccgcactttggtttaccgaggccgtccacattaccgtaaccgcactgatg
gtgccgattctcgccgtcgtactcggtttccccgacatggacatcaaaaaggcgatggct
gatttttccaacccgattatctacatttttttcggcggcttcgcgcttgccaccgccctg
catatgcagcggctggaccgtaaaatcgccgtcagcctgttgcgcctgtcgcgcggcaat
atgaaagtggcggttttgatgttgttcctcgttaccgcctttctgtccatgtggatcagc
aacaccgccaccgccgcgatgatgctgcctctagcaatgggtatgctgagccacctcgac
caggaaaaagaacacaaaacctacgtcttcctcctgctcggcatcgcctattgcgccagc
atcggcggcttgggcacgctcgtcggctcgccgcccaacctgattgccgccaaagcccta
aatctggacttcgtcggctggatgaagctcggcctgccgatgatgctgttgattctgccc
ttgatgctgctctccctgtacgtcatcctcaaacctaatttgaacgaacgcgtggaaatc
aaagccgaatccatcccttggacgctgcaccgcgtgatcgcgctgttgattttccttgcc
acagccgccgcgtggatattcagctccaaaatcaaaaccgccttcggcatttccaatccc
gacaccgttatcgccctgagtgccgccgtcgccgtcgtcgtcttcggcgtggcgcaatgg
aaggaagtcgcccgcaataccgactggggcgtgttgatgctcttcggcggcggcatcagc
ctgagcacgctgttgaaaacatccggcgcgtccgaagccttgggacagcaggttgccgcc
accttttccggcgcgcccgcatttttggtgatactcatcgtcgccgccttcattattttt
ctgaccgagttcaccagcaacaccgcctccgccgcattgcttgtaccgattttctccggc
atcgctatgcagatggggctgcccgaacaagtcttggtattcgtcatcggcatcggcgca
tcttgtgccttcatgctgccggttgccacaccgcctaacgcgattgtgttcggcacgggc
ttaatcaagcaacgcgaaatgatgaatgtcggcatactgctgaacatcctctgcgtagta
ttggttgctctgtgggcttatgctgtactgatgtaa

DBGET integrated database retrieval system