KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0801Help
Entry
NMB0801           CDS       T00027                                 

Gene name
hemB
Definition
(RefSeq) delta-aminolevulinic acid dehydratase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00860  Porphyrin and chlorophyll metabolism
nme01100  Metabolic pathways
nme01110  Biosynthesis of secondary metabolites
nme01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    NMB0801 (hemB)
Enzymes [BR:nme01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     NMB0801 (hemB)
Exosome [BR:nme04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NMB0801 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD
Motif
Other DBs
NCBI-GeneID: 902916
NCBI-ProteinID: NP_273843
UniProt: Q9K025
Position
827231..828232
Genome map
AA seq 333 aa AA seqDB search
MQFPYRNVPASRMRRMRRDDFSRRLMREHTLTADDLIYPVFVLEGSAREEDVPSMPGVKR
QSLDRLLFTAEEAVKLGIPMLALFPVVTANKTERAQEAYNPEGLVPSTVRALRERFPELG
IMTDVALDPYTVHGQDGLTDENGYVMNDETVEVLVKQALCHAEAGAQVVAPSDMMDGRIG
AIREALEDAGHIHTRIMAYSAKYASAFYGPFRDAVGSSGNLGKADKKTYQMDPANTDEAL
HEVALDIQEGADMVMVKPGLPYLDVVRRVKDEFGVPTYAYQVSGEYAMLQAAIANGWLDG
GKVVLESLLAFKRAGADGILTYYAIEAAKMLKR
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgcagtttccttaccgcaatgttccggcttcgcgtatgcgccgtatgcgcagggacgat
ttttcacgccgcctgatgcgcgaacacacgctgaccgccgatgatttgatttatccggtg
ttcgtattggaggggtcggcgcgcgaggaggatgtgccttctatgccgggtgtgaagcgt
caaagtttggacaggctgctgtttacggcggaagaggcggtaaagctcggtattccgatg
ttggcactgttccccgtggttacggcaaacaaaaccgagcgtgcgcaggaggcgtacaat
cccgaaggactcgtgccgtcaactgtccgcgccttgcgcgagaggtttcccgaactgggc
attatgacggatgtcgcgctcgatccttatacggttcacggtcaggacgggctgacggac
gaaaacggttatgtgatgaacgatgaaaccgtagaggttttggtcaagcaggctttgtgc
cacgctgaagcgggcgcgcaggtggttgccccttccgatatgatggacgggcgtatcggt
gcgattcgcgaggcgttggaggatgccgggcatatccatacgcggattatggcgtattcc
gccaaatatgcttctgcattttacggccctttccgtgatgcggtaggcagttcgggcaat
ttgggcaaggcagataaaaagacctaccagatggatccggcaaataccgatgaggcgttg
cacgaagtggcgttggacattcaggaaggtgcggatatggtaatggtcaagcccggtttg
ccgtatttggacgttgtccgccgcgtaaaggacgagttcggtgtgccgacttatgcctat
caggtttcgggagaatacgcgatgttgcaggcagcgattgccaacggctggctggacggc
ggcaaagtggttttggaaagcctgctggcattcaaacgtgcgggtgcggacgggattttg
acctattacgctattgaggcggcaaagatgttgaagcgttga

DBGET integrated database retrieval system