KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0807Help
Entry
NMB0807           CDS       T00027                                 

Gene name
ppnK
Definition
(RefSeq) inorganic polyphosphate/ATP-NAD kinase
  KO
K00858  
NAD+ kinase [EC:2.7.1.23]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    NMB0807 (ppnK)
Enzymes [BR:nme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.23  NAD+ kinase
     NMB0807 (ppnK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(833113..834003)
Genome map
AA seq 296 aa AA seqDB search
MNSPFHNIGIVTRPNTPDIQDTAHTLITFLKQHGFTVYLDEVGIKEGCIYTQDTVGCHIV
NKTELGQYCDLVAVLGGDGTFLSVAREIALRAVPIIGINQGHLGFLTQIPREYMTDKLLP
VLEGKYLAEERILIEAALIREGKTAERAIALNDAVLSRGGAGQMIEFEVFVNREFVYTQR
SDGLIVSTPTGSTAYSLAAGGPIMQAGLHAFTLVPICPQSMTNRPIAIPDTSEIEILVTQ
GGDARVHFDGQTHIDVQNLDRITIRRYRNPLRILHPTDYQYFKTLRQKLHWGEQLV
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgaacagcccttttcacaacatcggcatcgtaacccgccccaacacgcccgacatccaa
gacaccgcacacacgctgattacctttttgaagcagcacggctttaccgtctatctcgac
gaagtcggcataaaggaaggctgcatctatacccaagacaccgtcggctgccatatcgtc
aacaagaccgaactggggcaatactgcgacctggtcgccgttttaggcggagacggcacc
tttctctccgtcgcccgcgaaatcgccctgcgcgccgttccgattatcggcatcaaccaa
gggcatttgggcttcctgacccaaattccccgcgaatatatgacggacaagctattgccc
gttttagaagggaaataccttgccgaagagcgcatcctgattgaggccgcactcatccgc
gaaggcaaaaccgccgaacgcgccatcgccctcaacgatgccgtcctctcccgtggcggt
gccggacagatgattgagtttgaagtcttcgtcaatcgggaattcgtctatacccagcgt
tcggacgggctgattgtctccacccccaccggatcgaccgcctattcgcttgccgccggc
ggccccatcatgcaggcaggattacacgccttcacgctcgtccccatctgcccacaatcc
atgaccaaccgccccatcgccattccagacacgtccgaaatcgaaatcctcgttacccaa
ggcggcgacgcgcgcgtccatttcgacggtcaaacccatatcgacgtgcaaaacctcgac
cgcatcaccatccgccgctaccgaaatcccttacgcattttgcacccgaccgactaccaa
tatttcaaaaccctgcgccaaaaactgcactggggcgagcaattagtctaa

DBGET integrated database retrieval system