KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0828Help
Entry
NMB0828           CDS       T00027                                 

Gene name
rfaD
Definition
(RefSeq) ADP-L-glycero-D-manno-heptose-6-epimerase
  KO
K03274  
ADP-L-glycero-D-manno-heptose 6-epimerase [EC:5.1.3.20]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Lipopolysaccharide biosynthesis
Metabolic pathways
Module
ADP-L-glycero-D-manno-heptose biosynthesis
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    NMB0828 (rfaD)
Enzymes [BR:nme01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.20  ADP-glyceromanno-heptose 6-epimerase
     NMB0828 (rfaD)
Lipopolysaccharide biosynthesis proteins [BR:nme01005]
 Unusual sugar
  NMB0828 (rfaD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
851289..852293
Genome map
AA seq 334 aa AA seqDB search
MTIIVTGAAGFIGSNIVKALNQRGITDIVAVDNLSKGEKFKNLAECEIAHYLDKHEFIRQ
VREHILPYQNIEAVFHQGACSDTMNHDGLYMMDNNYQYTLDLLDWCQDERIPFLYASSAA
VYGKGEIFREERELEKPLNVYGYSKFLFDQVLRRRMKEGLTAQVVGFRYFNVYGQHEQHK
GRMASVAFHHFHQYREHGYVNLFGSNDGYGNGEQTRDFVSVEDVAKVNLYFFDHPELSGI
YNLGTGRSQQFNELAAATVNACRAAEGKPEMSLKELVEEELIRYIPFPDALKGKYQSFTQ
ADITKLREAGYKEEFFDVKSGVDRYVKWMLENLA
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgaccatcatcgtaacaggcgcggccggctttatcggcagcaacatcgtcaaagcactt
aatcaacgcggtattactgacattgttgccgtcgataatttgagcaaaggcgaaaaattc
aaaaaccttgccgagtgcgaaatcgcccattatctcgacaaacacgaattcatccgccaa
gtgagggaacacattttaccttatcaaaacatcgaagccgttttccatcaaggcgcgtgt
tccgatacgatgaaccacgacggtttgtatatgatggacaacaactaccagtacacgctg
gatttgctggactggtgtcaggacgaacgcatccccttcctttatgcctccagtgcggcg
gtttacggcaaaggagaaatcttccgcgaagagcgcgaactcgaaaaaccgctcaacgtg
tacggctactccaaattcctgttcgaccaagtattgcgtcgccgcatgaaagaaggtctc
accgcccaagtcgtcggcttccgctacttcaatgtttacggacaacacgaacaacacaaa
ggccgcatggcatccgtcgccttccaccacttccaccaataccgcgaacacggttacgtc
aacctgttcggcagtaacgacggctacggcaacggcgaacaaacccgcgacttcgtcagc
gtcgaagacgttgccaaagtcaacctctacttcttcgaccatcccgaactttccggcatc
tacaacctcggtaccggccgcagccaacagttcaacgaactcgccgccgccaccgtcaac
gcatgccgcgccgccgaaggcaaacctgaaatgagcttgaaagagttggtagaagaagaa
cttatccgctacattcccttccccgacgcgctcaaaggcaaataccaaagcttcacccaa
gccgacatcaccaaattgcgcgaagccggatataaggaagaatttttcgatgtcaaatca
ggcgtcgaccgctacgtcaaatggatgctggaaaatttggcttaa

DBGET integrated database retrieval system