KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0869Help
Entry
NMB0869           CDS       T00027                                 

Definition
(RefSeq) spermidine synthase
  KO
K00797  
spermidine synthase [EC:2.5.1.16]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Cysteine and methionine metabolism
Arginine and proline metabolism
beta-Alanine metabolism
Glutathione metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    NMB0869
   00330 Arginine and proline metabolism
    NMB0869
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    NMB0869
   00480 Glutathione metabolism
    NMB0869
Enzymes [BR:nme01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.16  spermidine synthase
     NMB0869
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
complement(888256..889047)
Genome map
AA seq 263 aa AA seqDB search
MARHPYRRLRPAKSGFPEVGISEEGNIRSLHLGSDTVQSSMNLDHPSELVLSYSRAMMGW
LLFTDALPQHITQIGLGGGSFARWIDTYLPDTRQTAVDINPQVIAIARNLFELPFEGEKF
EIIEADGAEYIKVFRHNTDVILVDGFDGEQIIDALVEEPFFRDCRNALSSDGIFVTNWWS
GDKRYQRFIERLLSVFEGRVLELPAESHGNVAVMAFQSSPKEQNIDKLKKRADKLSNAYG
LDFHRMLAGLKASNPNNGKHFHL
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atggcaagacatccctaccgccgcctgcgtcctgcaaaatccggctttcccgaagtcggc
atttccgaagaaggcaatatccgttcgcttcacttgggcagcgacaccgttcaaagctcg
atgaacctcgaccacccgtccgagctggtgctctcttacagccgcgcgatgatgggctgg
ctgctgtttaccgacgctcttccgcaacatatcacccaaatcggcttgggcggcggctcg
tttgcacgctggatagatacctacctgcccgacacgcgccaaaccgccgtggacatcaat
ccgcaggtcatcgccattgcccgcaacctgttcgagttgcctttcgagggcgagaaattt
gaaattattgaagcagacggtgcagaatatatcaaagtcttccgccacaacaccgatgtg
attttggtggacgggttcgacggcgaacaaatcatcgatgcgctggttgaagaaccgttc
ttccgagactgccgcaacgcactctcttcagacggcatattcgtaaccaactggtggagc
ggcgacaaacgctaccaacgcttcatcgaacggttgttgagcgtttttgaagggcgcgtc
ttggaacttcctgccgaaagccacggcaatgtcgcggtaatggccttccaaagcagcccc
aaagagcaaaacatagacaaactcaaaaaacgtgccgacaaactgagcaacgcatacgga
ttggacttccaccgtatgcttgccggcctgaaagcgtccaaccccaacaacggcaagcat
ttccacctttaa

DBGET integrated database retrieval system