KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0870Help
Entry
NMB0870           CDS       T00027                                 

Gene name
panB
Definition
(RefSeq) 3-methyl-2-oxobutanoate hydroxymethyltransferase
  KO
K00606  
3-methyl-2-oxobutanoate hydroxymethyltransferase [EC:2.1.2.11]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Pantothenate and CoA biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    NMB0870 (panB)
Enzymes [BR:nme01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.11  3-methyl-2-oxobutanoate hydroxymethyltransferase
     NMB0870 (panB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
889540..890331
Genome map
AA seq 263 aa AA seqDB search
MITVNTLQKMKAAGEKIAMLTAYESSFAALMDDAGVEMLLVGDSLGMAVQGRKSTLPVSL
RDMCYHTECVARGAKNAMIVSDLPFGAYQQSKEQAFAAAAELMAAGAHMVKLEGGVWMAE
TTEFLQMRGIPVCAHIGLTPQSVFAFGGYKVQGRGGKAQALLNDAKAHDDAGAAVVLMEC
VLAELAKKVTETVSCPTIGIGAGADCDGQVLVMHDMLGIFPGKTAKFVKNFMQGHDSVQA
AVRAYVAEVKAKTFPAAEHIFAD
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgattactgtgaacacactgcaaaaaatgaaggcggcgggcgaaaaaatcgctatgctg
accgcttacgaatccagttttgccgcgctgatggacgatgccggcgtggaaatgctgctg
gtcggcgattctttggggatggcggttcaggggcggaaatcgacgctgcccgtcagcctg
cgcgatatgtgttatcacaccgaatgtgtagcacgcggtgcaaaaaatgcgatgattgtc
agcgatttgccgtttggtgcatatcagcagagtaaggagcaggcgtttgccgccgccgcc
gaactgatggctgccggcgcgcatatggttaaactcgaaggcggcgtgtggatggcggaa
acgactgaatttttgcaaatgcgcggtattccggtttgtgcgcacatcggtctgaccccg
caatccgtgtttgccttcggcggatataaagttcaggggcgcggcggcaaggcgcaggcg
ttgcttaacgatgccaaggcgcatgacgatgcgggggcggcggtcgtgctgatggagtgc
gtactggcggaactggcaaaaaaggtaactgaaactgtttcctgtccgaccatcggcatc
ggcgcgggtgcggattgcgacgggcaggttttggtgatgcacgatatgctcggcattttc
ccgggtaagacggcgaaattcgtcaaaaactttatgcaggggcatgatagtgttcaagcg
gcggttcgggcgtatgttgccgaagtcaaagccaaaaccttccctgctgcggaacatatt
tttgcagattga

DBGET integrated database retrieval system