KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0871Help
Entry
NMB0871           CDS       T00027                                 

Gene name
panC
Definition
(RefSeq) pantoate--beta-alanine ligase
  KO
K01918  
pantoate--beta-alanine ligase [EC:6.3.2.1]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
beta-Alanine metabolism
Pantothenate and CoA biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    NMB0871 (panC)
  Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    NMB0871 (panC)
Enzymes [BR:nme01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.1  pantoate---beta-alanine ligase (AMP-forming)
     NMB0871 (panC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
890454..891290
Genome map
AA seq 278 aa AA seqDB search
MQIIHTIRELRAWRKNAGKVAFVPTMGNLHEGHLALVREAKKRADSVVVSIFVNRLQFGQ
GEDFDKYPRTLQQDADKLAAEGIAVVFAPDEKELYPNVEQRYNVEPPNLQNELCGKFRPG
HFRGVATVVSKLFHIVSPDIACFGKKDYQQLAVIKGFVEDLNFDVEIVPVDTGRAEDGLA
LSSRNQYLSAAERDEAPRLYRELKAVAESLVQGSLDYAGLEKRAVQSLTEYGWVVDYVEI
RRADTLEVARAGDKKLVVLAAACLGTTRLIDNLEIKLP
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgcaaatcatacataccattcgagaactgcgcgcgtggcgtaaaaatgcgggaaaggtg
gcatttgtgccgaccatgggcaatctgcatgaaggacatcttgcgcttgtgcgtgaggcg
aaaaaacgcgcggacagtgtcgtggtcagcattttcgtcaatcgcctgcaattcggtcag
ggcgaggatttcgacaaatatccgcgcactttgcaacaggatgcggacaaacttgccgcc
gaaggcattgccgttgttttcgcgcccgatgagaaagaactctatccgaacgtggaacag
cgttacaacgtcgaaccgcccaatctgcaaaatgagttgtgcggcaaattccgcccgggg
cattttcgcggtgtggcaacggttgtttctaaattgttccacatcgtttccccggacatt
gcctgttttggtaagaaggattaccagcagcttgccgtgattaaaggttttgtcgaagat
ttgaattttgatgttgaaatagtgcctgttgatacagggcgcgcggaagacgggttggca
ctgtcgagccgcaaccagtatttgagtgcggcggaacgcgacgaagcaccgcgcctgtac
cgcgaattaaaggctgttgccgaatccttggtgcagggcagtttggattatgcaggtttg
gaaaaacgtgccgtccaatccctgacagaatacggctgggtggtcgattatgtcgaaatc
cgccgcgccgatacgctcgaagtggcgcgggcgggagataagaaactggtggtcttggcc
gccgcctgtctggggacgacgcgcctgattgacaatttggaaataaaactcccttaa

DBGET integrated database retrieval system