KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0875Help
Entry
NMB0875           CDS       T00027                                 

Gene name
prsA
Definition
(RefSeq) ribose-phosphate pyrophosphokinase
  KO
K00948  
ribose-phosphate pyrophosphokinase [EC:2.7.6.1]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Pentose phosphate pathway
Purine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
PRPP biosynthesis, ribose 5P => PRPP
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NMB0875 (prsA)
   01230 Biosynthesis of amino acids
    NMB0875 (prsA)
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    NMB0875 (prsA)
  Nucleotide metabolism
   00230 Purine metabolism
    NMB0875 (prsA)
Enzymes [BR:nme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.1  ribose-phosphate diphosphokinase
     NMB0875 (prsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
895296..896279
Genome map
AA seq 327 aa AA seqDB search
MAAYDSLMVFTGNANPELAQRVVRHLDISLGNASVSKFSDGEVAVELLENVRGRDVFILQ
PTCAPTNDNLMEILTMADALKRASAGRITTAIPYFGYARQDRRPRSVRVPISAKLVANML
YSAGIDRVLTVDLHADQIQGFFDIPVDNIYATPILLNDIKQQRIENLTVVSPDIGGVVRA
RAVAKSLNADLAIIDKRRPKANVAEVMNIIGDIQGRTCLIVDDMIDTANTLCKAAVALKE
RGAERVLAYASHAVFSGEAVSRIASSEIDQVVVTDTIPLSEAAKNCDRIRQVTIAGLLAE
TVRRISNEESVSYLFNEEVMTGSMLLP
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atggctgcgtacgacagtttgatggtatttacaggcaatgccaatcccgaattggcacaa
cgtgttgtcaggcatttggacatttctttgggcaatgcttccgtatccaagttttcagac
ggcgaagttgccgtcgaactgttggaaaacgtacgcgggcgcgatgttttcatccttcag
ccgacctgtgcgccgaccaatgacaacctgatggaaatcctgacgatggcggatgcactg
aagcgtgcttcggcaggtcgtattaccacagccattccgtatttcggctatgcgcgccaa
gaccgccgtccgcgttccgtccgcgttccgatttctgccaaactggtggcaaatatgctg
tattcggcagggatcgaccgtgttttgactgtcgatttgcatgccgaccagattcaaggt
ttcttcgatattccggtggacaatatttatgccaccccgattctgttgaacgacatcaaa
caacagcggattgaaaatctgaccgtcgtcagcccggacatcggcggtgtcgtccgcgcc
cgcgccgtggcaaaatccctgaatgccgacttggcaatcatcgacaaacgccgcccgaaa
gccaatgtggcggaagtcatgaacatcatcggcgatattcaaggtagaacctgtctgatt
gtggacgatatgattgacactgcaaatacgctgtgcaaagccgccgtcgccctgaaagag
cggggggctgaacgtgttctagcctatgccagccacgccgtattctccggagaggcggtc
agccgtatcgcctcatccgaaatcgaccaggtggtcgtaaccgataccattcctttgtct
gaagcggctaaaaactgcgaccgtatccgtcaggtaacgattgccggtctgttggccgaa
accgtccgccgcattagcaatgaagaatccgtctcatatcttttcaatgaagaagtgatg
acaggcagcatgttgctgccataa

DBGET integrated database retrieval system