KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0878Help
Entry
NMB0878           CDS       T00027                                 

Gene name
ilvA
Definition
(RefSeq) threonine dehydratase
  KO
K01754  
threonine dehydratase [EC:4.3.1.19]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Glycine, serine and threonine metabolism
Valine, leucine and isoleucine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NMB0878 (ilvA)
   01230 Biosynthesis of amino acids
    NMB0878 (ilvA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NMB0878 (ilvA)
   00290 Valine, leucine and isoleucine biosynthesis
    NMB0878 (ilvA)
Enzymes [BR:nme01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.1  Ammonia-lyases
    4.3.1.19  threonine ammonia-lyase
     NMB0878 (ilvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
898360..899886
Genome map
AA seq 508 aa AA seqDB search
MNTPLPYSDYLIRILTASVYDVAVETPLEPARSLSVRLKNNILLKREDLQPVFSFKIRGA
YNKMSKLPKDALACGVIAASAGNHAQGVALSAQRLGCRAVIVMPETTPKIKVDAVKSHGG
EVVLRGVSYNDAYDYAMELAEKEGLTYIAPFDDPDVIAGQGTVGMEIVSQHPDPIRAVFV
PIGGGGLAAGVAAFIKQVRPEIKVIGVQTNDSCCMKQSVEAGEIVHLKDVGLFSDGTAVK
VVGNETFRLCKELLDEIITVDTDAVCGAVKDIFDDTRSITEPAGALALAGLKAYIAREGA
ENQTLIAVTSGANMNFHRLRHVSERSELGEGNEGIFAVTIPEERGSFLKFVNILGNRNIT
EFNYRYGDDEKAHIFVGLQAAGPQDLAVIGSRLDEAGLPNVDLTNNEIAKIHIRYMVGGR
TDKVENERLVSFEFPERPGALARFLNHMQGGWNITLFHYRNHGADYGRILVGIDVPPHDA
AAFDGFLESLGYSYHEETQNAAYKLFLA
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgaacacgccccttccttattccgattacctcatccgcatcctgacggcatctgtctat
gatgtggcggtcgaaacgcctttggaaccggcacgcagcctttctgtacgtttgaaaaac
aacatccttttgaaacgcgaagatttgcagccggttttttcgttcaaaatacgcggcgcg
tacaacaaaatgtccaagttgccgaaagatgcgctcgcttgcggcgtgattgcggcaagc
gcgggcaatcatgctcaaggcgtggcattgtccgcacagcgtttgggctgccgtgccgtt
atcgttatgccggagactacgccgaaaatcaaagtggatgcggttaaaagccatggcggc
gaggtggttttgcggggcgtttcatacaacgatgcctacgattatgcgatggagttggcg
gaaaaagaagggttaacctatatcgcgccgtttgatgatcctgatgtgattgcgggacag
gggacggtggggatggaaattgtcagccagcatcccgatccaatccgcgccgtattcgta
ccgataggcggtggcggtttggcggcgggcgtggcggcatttatcaagcaggtccgtccc
gaaatcaaagttatcggcgttcagaccaacgattcctgctgtatgaagcagtcggtcgaa
gcgggtgaaatcgtccatttgaaagatgtcgggctgttttcagacggcactgcggtcaaa
gtcgtcggaaacgaaaccttccgcctctgcaaagaacttttggatgaaatcattacagtc
gataccgatgcggtttgcggcgcggtcaaggatattttcgatgacacgcgcagcattacc
gagccggcgggcgcgttggcgttggcgggtctgaaagcctatatcgcccgagaaggcgcg
gaaaaccaaaccctgattgccgttaccagcggtgcgaatatgaattttcaccgtttgcgc
cacgtttcggaacggagcgaattgggcgagggcaacgaaggtatttttgccgttaccatc
cctgaagaacgcggcagcttccttaagtttgtcaatatattgggaaataggaatattacc
gagttcaactaccgctacggagacgatgaaaaagcgcatatctttgtcggacttcaagcg
gcaggcccgcaggatttggcggttatcggcagccggttggatgaggcgggattgcccaat
gtcgatttgaccaacaatgagattgccaaaatccatatccgctatatggtcggagggcgg
acggacaaagtagaaaacgagcgtttggtcagttttgagtttccggagcgtccgggggca
ttggcacgctttttgaaccatatgcagggagggtggaatattacgcttttccattaccgc
aaccacggtgcggattacgggcggattttggtcggtatcgatgtgccgccgcacgatgcc
gccgcatttgacggtttcttggaaagtctgggatacagctatcacgaggaaacgcaaaat
gccgcgtacaagctgtttcttgcctga

DBGET integrated database retrieval system