KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0884Help
Entry
NMB0884           CDS       T00027                                 

Gene name
sodB
Definition
(RefSeq) superoxide dismutase
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Brite
Enzymes [BR:nme01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     NMB0884 (sodB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(904942..905529)
Genome map
AA seq 195 aa AA seqDB search
MEHKLPQLPYELDALSPHLSKETLEFHYGKHHQTYITNLNNQIKGTEFENLPLEEIVKKS
SGGVFNNAAQTWNHTFYWLGFTSKGQGKPAGELAAAIDAKWGSFEKFQEAFNACAAGTFG
SGWAWLVKTPAGGLDLVSTSNAATPLTTENTPLLTCDVWEHAYYIDYRNSRPNYLKGFWE
IVNWDEVAKRFAALS
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atggaacataagctgccgcaactgccttatgaactggacgcattgtccccgcatctgagc
aaagagactttggagttccactacggcaaacaccatcaaacctacatcaccaacctgaac
aatcaaatcaaaggcaccgaatttgaaaacctgcctttggaagagattgtgaaaaaatct
tcaggcggcgtgttcaacaacgcggcacaaacttggaaccacaccttctactggctgggt
ttcacgtccaaaggtcaaggcaaacctgccggcgaactggccgccgccatcgacgcgaaa
tggggcagcttcgagaaattccaagaagcgttcaatgcctgcgcggccggtactttcggc
tccggttgggcgtggctggtaaaaacccctgccggcggattggatttggtttctacttcc
aacgccgctacgccgctgaccactgaaaacacgccgctgctgacctgcgacgtgtgggaa
cacgcctattacatcgactaccgcaacagccgtcccaactacctgaaaggtttttgggaa
atcgtcaactgggacgaagtcgccaaacgttttgccgccttgtcctga

DBGET integrated database retrieval system