KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0892Help
Entry
NMB0892           CDS       T00027                                 

Definition
(RefSeq) AzlC-like protein
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
complement(912411..912833)
Genome map
AA seq 140 aa AA seqDB search
MLIGLLPWALILGMQGGQKGMSWLEMLLMTSMNFAGGSEFATVNLWAEPLPILLIATVTF
MINSRHILMGAALAPHLKGIPLKKAVPALFFMCDESWAMAFSEIQKRKAAGLPAFNMPFY
SGLTKTSTALPRLSSKKTIL
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atgctgattgggctgctgccttgggcattaatactcggtatgcagggcggacaaaaaggc
atgagctggctggaaatgttgttgatgaccagtatgaacttcgccggcggctccgagttt
gccacggtcaacctgtgggcggaacctctgccgatactgcttatcgccaccgtaaccttt
atgattaattctcggcatatcctgatgggggcggcgcttgccccgcacctgaaaggaata
ccgctgaaaaaagccgtgcccgcactgttttttatgtgtgatgaaagctgggcgatggca
ttctccgaaatccaaaaacggaaagcagccggtttgcccgcattcaatatgcctttttat
agtggattaacaaaaaccagtacagcgttgcctcgccttagctcaaagaaaacgattctc
taa

DBGET integrated database retrieval system