KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0894Help
Entry
NMB0894           CDS       T00027                                 

Definition
(RefSeq) succinyldiaminopimelate transaminase
  KO
K14267  
N-succinyldiaminopimelate aminotransferase [EC:2.6.1.17]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    NMB0894
Enzymes [BR:nme01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.17  succinyldiaminopimelate transaminase
     NMB0894
Amino acid related enzymes [BR:nme01007]
 Aminotransferase (transaminase)
  Class I
   NMB0894
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Structure
PDB: 

Jmol
Position
913563..914750
Genome map
AA seq 395 aa AA seqDB search
MNTLLNQLKPYPFARLREAMQGISAPEGLEAVPLHIGEPKHPTPKVITDALTASLHELEK
YPLTAGLPELRQACANWLKRRYDGLTVDADNEILPVLGSREALFSFVQTVLNPVSDGIKP
AIVSPNPFYQIYEGATLLGGGEIHFANCPAPSFNPDWRSISEEVWKRTKLVFVCSPNNPS
GSVLDLDGWKEVFDLQDKYGFIIASDECYSEIYFDGNKPLGCLQAAAQLGRSRQKLLMFT
SLSKRSNVPGLRSGFVAGDAELLKNFLLYRTYHGSAMSIPVQRASIAAWDDEQHVIDNRR
MYQEKFERVIPILQQVFDVKLPDASFYIWLKVPDGDDLALARNLWQKAAIQVLPGRFLAR
DTEQGNPGEGYVRIALVADVATCVKAAETIVSLYR
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgaataccttactcaaccaactcaaaccatatccctttgcccgactgcgtgaagcgatg
cagggcatttccgcgcccgaaggtctggaagccgtccccctgcacattggcgaaccgaaa
catccgacaccgaaagtcattacggatgcgctgaccgcctcattgcacgagttggaaaaa
tatccgctgacggccggtctgcctgaactgcgtcaggcgtgtgcaaactggttaaaacgc
cgttacgatggcttgacagtggatgcggataatgaaattctgccggttttaggcagtagg
gaggcgttgttttcttttgttcaaaccgtgttgaaccctgtttcagacggcatcaaaccc
gcaattgtcagcccgaatcccttttatcagatttacgaaggtgcgacacttttgggcggc
ggtgaaatccattttgccaattgccccgcgccgtctttcaaccccgattggcgcagtatt
tccgaagaggtttggaaacgcaccaaactggtgttcgtctgctcgcccaacaaccccagc
ggcagcgtgctggatttggacggctggaaagaagtttttgatttacaggataaatatggt
ttcattattgcctcggatgaatgctattccgaaatctatttcgacggcaacaaacctttg
ggctgcctgcaagccgctgcacagttgggtcgaagcaggcaaaaactgcttatgttcacc
agtttgtccaagcgttccaacgttccgggcctgcgttccggttttgtcgccggcgatgcc
gaactgcttaaaaactttctgctttacagaacctatcacggcagtgcaatgagtattccc
gtgcagcgcgcaagcattgccgcttgggatgatgaacagcacgttatcgacaaccgccgt
atgtatcaggaaaaatttgagcgcgttattcccattttgcaacaggtatttgacgttaaa
ttaccggatgcctcgttttacatctggttgaaagtccctgatggcgacgatttggcactt
gcacgcaatttatggcaaaaagcggctatccaagtattgcccggacgttttttggcgcgg
gataccgaacagggcaatcccggggaaggttatgtgcgtatcgctttggttgccgatgtc
gcaacttgtgtcaaagctgcggaaaccattgtttccctatatcggtaa

DBGET integrated database retrieval system