KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0920Help
Entry
NMB0920           CDS       T00027                                 

Gene name
icd
Definition
(RefSeq) isocitrate dehydrogenase
  KO
K00031  
isocitrate dehydrogenase [EC:1.1.1.42]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Citrate cycle (TCA cycle)
Glutathione metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NMB0920 (icd)
   01210 2-Oxocarboxylic acid metabolism
    NMB0920 (icd)
   01230 Biosynthesis of amino acids
    NMB0920 (icd)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NMB0920 (icd)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    NMB0920 (icd)
Enzymes [BR:nme01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     NMB0920 (icd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(932130..934355)
Genome map
AA seq 741 aa AA seqDB search
MTQKSTIVYTHTDEAPALATQSLLPIVQAFARHADIDVKTSDISLSGRILAAFPEYLTEA
QRVPDALAELGELVKQPDANVIKLPNISASVPQLTAAIKELQSKGFAVPDYPADPQTDEE
KAVRERYDRIKGSAVNPVLREGNSDRRAPKAVKNFAKKNPHSMGAWTKDSKTHVATMQSG
DFFHNEQSVIVPEATSVSIVFTDKQGNKKELREPVALKAGEIIDATVMSKKALLAFLAEQ
VKDAKAKGVLFSLHMKATMMKVSDPIIFGHAVKVFFAPVFEKFGDKLAAAGVNVNNGFGN
LLANLDKLDADTRTAVEAEIAAVYAANPDLAMVDSDKGITNLHVPSDVIVDASMPAMIRN
SGRMWDKNGKAQDTKAVIPDSSYAGVYQATIDFCREHGAFDPTTMGTVPNVGLMAQAAEE
YGSHNKTFEIEADGQVQVIDAAGKVLMQHDVEAGDIWRMCQTKDAPVKDWVQLAVNRARL
SNTPAVFWLDENRPHDKSLLAKVKAYLAELDTNGLDIRVLAPEEAAKFSLGRLKNGEDTI
SVTGNVLRDYLTDLFPILELGTSAKMLSIVPLMNGGGMFETGAGGSAPKHVQQFLEENHL
RWDSLGEFLALAVSFEHLAQKTGNAKAQVLADTLDAATEKLLLNDKSPKRKAGELDNRGS
HFYLTLYWAQELAAQDKDAELKAAFTPLAAALTADEAKIVAELSAVQGKAADIGGYYAAN
PEKAAQVMRPSVTFNQALNAL
NT seq 2226 nt NT seq  +upstreamnt  +downstreamnt
atgactcaaaaatccaccattgtttatacccataccgacgaagcacccgcgctggcgacc
caatcgctgctgccgattgtgcaggcttttgcccgccacgccgatattgatgtcaaaacc
agcgacatttctctctccggccgtattttggcggcgtttcccgaatacctgaccgaagcg
caacgcgtacctgatgcgcttgccgaattgggcgaactggtgaaacaacccgatgcaaac
gtaatcaaactgccgaacatcagcgcgtccgtaccgcaactgactgccgcgattaaagaa
ttgcaatctaaaggctttgccgttcccgactatcccgccgacccgcaaaccgatgaagaa
aaagccgtacgcgaacgctacgaccgcatcaaaggcagcgcggtaaaccctgtcctgcgt
gaaggcaactccgaccgtcgcgcccctaaagcagtgaaaaactttgcgaaaaaaaatccg
cacagcatgggcgcatggaccaaagactccaaaacccacgttgccaccatgcaaagcggc
gacttttttcataacgaacaatctgttatcgtacctgaagcgacttccgtatccatcgta
ttcaccgacaaacaaggcaacaaaaaagagctgcgcgagcccgtcgccctgaaagccggc
gaaatcatcgacgcgaccgtgatgagtaaaaaagccctgctcgccttccttgccgaacaa
gtaaaagatgcgaaagcaaaaggcgtgttgttctcgctgcacatgaaagccactatgatg
aaagtgtccgacccgattatcttcggacacgccgtcaaagtattcttcgcgcctgttttt
gaaaaattcggcgacaaactggctgctgccggcgtcaacgttaacaacggcttcggcaac
ctgcttgccaatctggacaaactggatgcggacacccgcaccgccgtcgaagccgaaatc
gccgccgtttacgctgccaaccccgatttggcgatggttgattccgacaaaggcatcacc
aacctgcacgttcccagcgatgtcatcgtcgatgcctctatgcctgcgatgattcgcaat
tccggccgtatgtgggacaaaaacggcaaagcgcaagacaccaaagccgtgattcccgac
agcagctatgccggcgtttaccaagcaaccatcgacttctgccgcgaacacggcgcattt
gacccgacaaccatgggtactgtgcccaacgtcggactgatggcgcaagcggcggaagaa
tacggctcgcacaacaaaacctttgaaatcgaagccgacggccaagtccaagtcattgat
gcggcaggaaaagtcctaatgcagcacgacgttgaagccggcgacatctggcgtatgtgc
caaaccaaagacgctccggttaaagactgggtacaacttgccgtcaaccgcgcccgtctg
agcaacacgcctgccgtgttctggctcgacgaaaaccgtccgcacgacaagagcctgctc
gccaaggttaaagcctaccttgccgaactggataccaatggcctcgacatccgcgtcctc
gctcctgaagaagccgccaagttcagcttgggtcgtctgaaaaacggcgaagacaccatc
tccgtaaccggtaatgtcttgcgcgactacctgaccgacttgttcccaattttggaactc
ggcacaagcgcgaaaatgctgtctatcgttccattgatgaacggcggcggtatgtttgaa
accggcgcgggcggttctgcaccgaaacatgttcaacaattcctcgaagaaaaccatttg
cgctgggactcgctgggcgaattcctcgcactcgccgtatcgtttgaacatttggcgcaa
aaaaccggcaatgccaaagcccaagtcctcgccgacactttggatgcagccaccgaaaaa
ctgctgttgaacgacaaatcgcctaaacgtaaagccggcgaactcgacaaccgcggcagc
catttctacctcaccctctactgggcgcaagaattggcggcgcaagacaaagatgccgaa
ctgaaagccgcatttacgccattggcagccgctttgaccgccgacgaagcgaaaatcgtt
gccgagctttccgccgtacaaggcaaagcggccgacatcggcggctactacgccgccaat
cctgaaaaagccgcacaagtgatgcgtccgagcgtaacctttaatcaggcactaaacgcc
ttataa

DBGET integrated database retrieval system