KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0922Help
Entry
NMB0922           CDS       T00027                                 

Definition
(RefSeq) alpha-2,3-sialyltransferase
  KO
K00785  
beta-galactosamide-alpha-2,3-sialyltransferase [EC:2.4.99.-]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Brite
Enzymes [BR:nme01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.-  
     NMB0922
Glycosyltransferases [BR:nme01003]
 Terminal extension
  Bacterial sialyltransferase
   NMB0922
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Structure
PDB: 

Jmol
Position
934788..935903
Genome map
AA seq 371 aa AA seqDB search
MGLKKACLTVLCLIVFCFGIFYTFDRVNQGERNAVSLLKEKLFNEEGEPVNLIFCYTILQ
MKVAERIMAQHPGERFYVVLMSENRNEKYDYYFNQIKDKAERAYFFHLPYGLNKSFNFIP
TMAELKVKSMLLPKVKRIYLASLEKVSIAAFLSTYPDAEIKTFDDGTGNLIQSSSYLGDE
FSVNGTIKRNFARMMIGDWSIAKTRNASDEHYTIFKGLKNIMDDGRRKMTYLPLFDASEL
KTGDETGGTVRILLGSPDKEMKEISEKAAKNFKIQYVAPHPRQTYGLSGVTTLNSPYVIE
DYILREIKKNPHTRYEIYTFFSGAALTMKDFPNVHVYALKPASLPEDYWLKPVYALFTQS
GIPILTFDDKN
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgggcttgaaaaaggcttgtttgaccgtgttgtgtttgattgttttttgtttcgggata
ttttatacatttgaccgggtaaatcagggggaaaggaatgcggtttccctgctgaaggag
aaacttttcaatgaagagggggaaccggtcaatctgattttctgttataccatattgcag
atgaaggtggcggaaaggattatggcgcagcatccgggcgagcggttttatgtggtgctg
atgtctgaaaacaggaatgaaaaatacgattattatttcaatcagataaaggataaggcg
gagcgggcgtactttttccacctgccctacggtttgaacaaatcgtttaatttcattccg
acgatggcggagctgaaggtaaagtcgatgctgctgccgaaagtcaagcggatttatttg
gcaagtttggaaaaagtcagcattgccgcctttttgagcacttacccggatgcggaaatc
aaaacctttgacgacgggacaggcaatttaattcaaagcagcagctatttgggcgatgag
ttttctgtaaacgggacgatcaagcggaattttgcccggatgatgatcggagattggagc
atcgccaaaacccgcaatgcttccgacgagcattacacgatattcaagggtttgaaaaac
attatggacgacggccgccgcaagatgacttacctgccgctgttcgatgcgtccgaactg
aagacgggggacgaaacgggcggcacggtgcggatacttttgggttcgcccgacaaagag
atgaaggaaatttcggaaaaggcggcaaaaaacttcaaaatacaatatgtcgcgccgcat
ccccgccaaacctacgggctttccggcgtaaccacattaaattcgccctatgtcatcgaa
gactatattttgcgcgagattaagaaaaacccgcatacgaggtatgaaatttataccttt
ttcagcggcgcggcgttgacgatgaaggattttcccaatgtgcacgtttacgcattgaaa
ccggcttcccttccggaagattattggctcaagccggtgtatgccctgtttacccaatcc
ggcatcccgattttgacatttgacgataaaaattaa

DBGET integrated database retrieval system