KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0924Help
Entry
NMB0924           CDS       T00027                                 

Definition
(RefSeq) short chain dehydrogenase/reductase oxidoreductase
  KO
K16066  
3-hydroxy acid dehydrogenase / malonic semialdehyde reductase [EC:1.1.1.381 1.1.1.-]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Pyrimidine metabolism
Glycine, serine and threonine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    NMB0924
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NMB0924
Enzymes [BR:nme01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.381  3-hydroxy acid dehydrogenase
     NMB0924
    1.1.1.-  
     NMB0924
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
936645..937466
Genome map
AA seq 273 aa AA seqDB search
MAVLITGASAGFGEAMCRAFVGAGYRVIGAARRADRLQALADELGALFYPLEMDVSRRES
VENALNGIPDEFSDIDCLINNAGLALGLDTADKADFEDWETMIQTNVLGLTFLTRKILPQ
MVERGGGYVMNLGSIAGNYAYAGSNVYGATKAFVRQFSLNLRAELADKNIRVTNIEPGLC
GNTEFSNVRFKGDDERAAGVYEGVEFIRPEDIAETALWLYQRPAHMNVNTIEIMPVAQTF
AGMKVIKKAVPEVREDFEKQSMSLFSRIRSWFK
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atggctgttttaattaccggtgcttcggcaggattcggcgaagcgatgtgccgtgcgttt
gtcggggcgggataccgcgttatcggtgcggcgcgccgtgcggacaggcttcaggccttg
gcggatgaattgggtgctttgttttaccctttggaaatggacgtgtcgcgacgcgagtcg
gtggaaaacgccttaaacggcatccccgatgaattttccgacatcgactgcctcatcaac
aatgccgggctggctttgggtctggacacggcggacaaggcggattttgaagattgggaa
acgatgattcaaaccaatgttttgggtttgacgttcctgacgcgcaaaattttgccgcaa
atggtggaacgcggcggcggttatgtgatgaatttgggttcgattgcaggcaattatgct
tatgccggcagcaacgtttacggggcgaccaaggcgtttgtgcgccagttcagcctgaat
ttgcgcgcggagttggcggataagaacatccgcgttaccaatatcgagccgggtttgtgc
ggcaatacggagttttccaatgtgcgcttcaaaggcgatgacgagagggcggcgggcgtg
tatgagggtgtggaatttatccgccccgaagatattgcggaaaccgcattgtggctgtac
cagcggccggcgcatatgaatgtgaacacgattgaaattatgcccgtggcgcagactttt
gcaggaatgaaagtgataaaaaaagccgtgcccgaagtgcgggaagactttgaaaaacag
agtatgtcgctgttttcccgcatcaggtcctggttcaaatga

DBGET integrated database retrieval system