KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0929Help
Entry
NMB0929           CDS       T00027                                 

Gene name
dapA
Definition
(RefSeq) 4-hydroxy-tetrahydrodipicolinate synthase
  KO
K01714  
4-hydroxy-tetrahydrodipicolinate synthase [EC:4.3.3.7]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Monobactam biosynthesis
Lysine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NMB0929 (dapA)
  Amino acid metabolism
   00300 Lysine biosynthesis
    NMB0929 (dapA)
  Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    NMB0929 (dapA)
Enzymes [BR:nme01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.3  Amine-lyases
    4.3.3.7  4-hydroxy-tetrahydrodipicolinate synthase
     NMB0929 (dapA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(944072..944947)
Genome map
AA seq 291 aa AA seqDB search
MLQGSLVALITPMNQDGSIHYEQLRDLIDWHIENGTDGIVAVGTTGESATLSVEEHTAVI
EAVVKHVAKRVPVIAGTGANNTVEAIALSQAAEKAGADYTLSVVPYYNKPSQEGIYQHFK
TIAEATSIPMIIYNVPGRTVVSMTNDTILRLAEIPNIVGVKEASGNIGSNIELINRAPEG
FVVLSGDDHTALPFMLCGGHGVITVAANAAPKLFADMCRAALQGDIALARELNDRLIPIY
DTMFCEPSPAAPKWAVSALGRCEPHVRLPLVPLTENGQAKVRAALKASGQL
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgttacaaggtagcttggttgccctgattaccccgatgaatcaagacggcagcatccat
tacgaacaactccgcgacttaatcgactggcacattgaaaacggcacggacggcatcgtt
gccgtcggcacgacaggcgaatccgccaccctctccgtcgaagaacacaccgccgtcatc
gaagccgtcgtcaaacacgttgccaaacgcgtccccgtcatcgccggcacaggggcaaac
aacaccgtcgaagccatcgccctttcccaagccgccgaaaaagccggggcggactacacc
ctctccgtcgtcccctattacaacaagccctcccaagaaggcatttaccaacatttcaaa
accatcgccgaagccacttcgattccgatgattatctacaacgtgcccggccgtaccgtc
gtcagcatgactaacgacactatcctgcgccttgccgaaatccccaacatcgtcggcgtg
aaagaagccagcggcaacatcggcagcaacatcgaactcatcaaccgcgcgcccgaaggc
ttcgtcgtcctttccggcgacgaccacaccgccctgccgttcatgctctgcggcggacac
ggcgtgattaccgtagccgccaacgccgcgcccaagctctttgccgatatgtgccgcgcc
gcgcttcaaggcgatatcgcccttgcacgcgaactcaacgaccgactgattccgatttac
gacaccatgttctgcgaacccagccccgccgcaccgaaatgggcggtatccgccctgggc
agatgcgaaccgcacgtccgcctgccgctcgttccgctgacggaaaacggacaagcaaaa
gtccgcgccgccctgaaagcctcaggacaactttaa

DBGET integrated database retrieval system