KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0930Help
Entry
NMB0930           CDS       T00027                                 

Definition
(RefSeq) xanthine/uracil permease
  KO
K16345  
xanthine permease XanP
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Brite
Transporters [BR:nme02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   NMB0930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
945407..946798
Genome map
AA seq 463 aa AA seqDB search
MSGQLGKGADAPDLVYGLEDRPPFGNALLSAVTHLLAIFVPMITPALIVGGALELPVEMT
AYLVSMAMVASGVGTYLQVNRFGPVGSGMLSIQSVNFSFVTVMIALGAGMKEGGLTKDAM
ISTLLGVSFVGAFLVCFSAWLLPYLKKVITPTVSGVVVMLIGLSLVHVGITDFGGGFGAK
ADGTFGSMENLGLASLVLLIVLVFNCMKNPLLRMSGIAVGLIAGYIVALFLGKVDFSALQ
NLPLVTLPVPFKYGFAFDWHAFIVAGAIFLLSVFEAVGDLTATAMVSDQPIEGEEYTKRL
RGGVLADGLVSVIATALGSLPLTTFAQNNGVIQMTGVASRHVGKYIAVILVLLGLFPVVG
RAFTTIPSPVLGGAMVLMFGLIAIAGVRILVSHGIRRREAVIAATSVGLGLGVAFEPEVF
KNLPVLFQNSISAGGITAVLLNLVLPEDKTEAAVKFDTDHLEH
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgagcggtcagttgggcaaaggtgcggatgcgcctgatttggtgtacggtttggaagac
aggccgccgttcggtaatgcgctcttgagcgcggttacccatcttttggcgatttttgtg
ccgatgattacgcccgcgctgattgtgggcggcgcgctggaattgccggtggagatgacg
gcgtatctcgtgtcgatggcgatggttgcgtcgggtgtcggcacttatttgcaggtcaac
cgcttcgggccggtcggttcggggatgctgtccatccagtcggtgaatttttcgttcgtt
accgtgatgattgcgctgggcgcggggatgaaagagggcggtttgactaaggatgcgatg
atttcgacgctcttgggcgtatcgtttgtcggcgcgtttttggtgtgtttctcggcgtgg
cttctgccgtatttgaaaaaagtgattacgccgacggtcagcggcgtggtcgtgatgctc
attggtttgagtttggtacacgtcggcattaccgatttcggcggcggcttcggcgcgaag
gcggacggcacgttcggctcgatggaaaacttggggctggcatcgctggtgttgctgatt
gtgttggtgttcaactgcatgaaaaacccgctgttgcgcatgagcggcattgcggtcggg
ctgattgccggctatatcgtcgcgctgtttttgggcaaggtggatttttccgcgctgcaa
aacctgccgctggttacgctgcccgtaccgtttaaatacggttttgctttcgactggcac
gcgtttattgtggcgggcgcgattttcttgttgagcgtgtttgaggcggtcggcgattta
accgcgacggcaatggtgtccgaccagccgattgaaggcgaggaatacaccaaacgcctg
cgcggcggcgtgttggctgacggcttggtgtcggtgattgcgacggctttgggttcgctg
ccgctgacgacgtttgcgcaaaacaacggcgtgattcagatgaccggcgtggcttcgcgc
catgtgggcaaatatattgccgtgattttggtgctgttgggtctgttccccgttgtcggt
cgcgcgtttacgacgattccgagtccggtgttgggcggcgcgatggttttgatgttcggc
ttaattgcgattgcgggcgtgcggattttggtcagtcacggcatccgcaggcgcgaagcg
gtgattgcggcaacgtcggtcggtttgggcttgggtgtcgcgtttgagccggaagtgttt
aaaaacctgcccgtcttgttccaaaactctatttccgccggcggcattacggcagtcttg
ctgaatttggtcttgcccgaagataaaaccgaggcggcggtcaagtttgataccgaccac
ttggaacactga

DBGET integrated database retrieval system