KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0940Help
Entry
NMB0940           CDS       T00027                                 

Gene name
metX
Definition
(RefSeq) homoserine O-acetyltransferase
  KO
K00641  
homoserine O-acetyltransferase [EC:2.3.1.31]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    NMB0940 (metX)
Enzymes [BR:nme01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.31  homoserine O-acetyltransferase
     NMB0940 (metX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(953968..955107)
Genome map
AA seq 379 aa AA seqDB search
MSQNASVGIVMPQKIPFEMPLVLENGKTLPRFDLMIETYGELNAEKNNAVLICHALSGNH
HVAGRHSAEDKYTGWWDNMVGPGKPIDTERFFVVGLNNLGGCDGSSGPLSINPETGREYG
ADFPVVTVKDWVKSQAALADYLGIEQWAAIVGGSLGGMQALQWTISYPERVRHALVIASA
PKLSTQNIAFNDVARQAILTDPDFNEGHYRSHNTVPARGLRIARMMGHITYLAEDGLGKK
FGRDLRSNGYQYGFGVEFEVESYLRYQGDKFVGRFDANTYLLMTKALDYFDPAADFGDSL
TRALQNVKAKFFVASFSTDWRFAPERSHELVKALIAAQKSVQYIEVKSAHGHDAFLMEDE
AYMRAVAAYMNNVYKECQQ
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaaaatgcctcggtgggcattgtaatgccccaaaaaattccgtttgagatgccg
ctggttttggaaaacggtaaaactttgccgcgtttcgatctgatgattgaaacctacggc
gagctgaatgctgaaaaaaacaatgcggttttaatctgccacgcgctgtcgggcaaccat
catgttgcgggcaggcattcggcggaagataaatatacgggctggtgggacaatatggtc
ggacctggcaaaccgattgatacggaacgttttttcgtggtcggtttgaataatctgggc
ggctgcgacggcagcagcgggcctttgtcgattaatcctgaaacgggcagggaatacggc
gcggattttccggtggttacggtgaaggactgggtaaaatcccaagccgcgcttgccgac
tatctcggtatcgaacaatgggcggcgattgtcggtggcagcttgggcggtatgcaggcc
ttgcagtggacgatttcctatcccgagcgcgtgcgccatgctttagtgattgcgtctgcg
ccgaaactgtccacgcaaaatatcgcgtttaacgatgtggcgcgtcaggcaattttgacc
gaccctgatttcaatgaaggacattaccgcagccacaataccgttcctgcacggggcttg
cggattgcccgcatgatgggacacatcacttatcttgccgaagacggtttaggcaaaaaa
ttcggacgcgatttgcgttccaacggttatcaatacggctttggtgttgaatttgaagtg
gaatcctatcttcgctatcagggcgacaaattcgtcggacggttcgacgccaacacttac
ctgctcatgaccaaggctttggactatttcgatccggcggcagatttcggcgacagcctg
acccgcgccctgcaaaatgtgaaagcgaaattctttgtcgccagcttcagcaccgactgg
cgtttcgcacccgaacgttcgcacgaactggtcaaggcactgattgccgcccaaaaatcc
gtgcagtatatcgaagtcaaatccgcacacgggcacgatgcctttttaatggaagacgaa
gcctatatgcgtgcggtcgccgcctatatgaacaacgtttataaggaatgtcagcaatga

DBGET integrated database retrieval system