KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0944Help
Entry
NMB0944           CDS       T00027                                 

Gene name
metH
Definition
(RefSeq) 5-methyltetrahydropteroyltriglutamate/homocysteine S-methyltransferase
  KO
K00549  
5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase [EC:2.1.1.14]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Cysteine and methionine metabolism
Selenocompound metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NMB0944 (metH)
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    NMB0944 (metH)
  Metabolism of other amino acids
   00450 Selenocompound metabolism
    NMB0944 (metH)
Enzymes [BR:nme01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.14  5-methyltetrahydropteroyltriglutamate---homocysteine S-methyltransferase
     NMB0944 (metH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
957285..959561
Genome map
AA seq 758 aa AA seqDB search
MTTLHFSGFPRVGAFRELKFAQEKYWRKEISEQELLAVAKDLREKNWKHQVAANADFVAV
GDFTFYDHILDLQVATGAIPARFGFDSQNLSLEQFFQLARGNKDQFAIEMTKWFDTNYHY
LVPEFHADTEFKANAKHYVQQLQEAQALGLKAKPTVVGPLTFLWVGKEKGAVEFDRLSLL
PKLLPVYVEILTALVEAGAEWIQIDEPALAVDLPKEWVEAYKDVYATLSKVSAKILLSTY
FGSVAEHAALLKALPVDGLHIDLVRAPEQLDAFADYDKVLSAGVIDGRNIWRANLNKVLE
TVEPLQAKLGDRLWISSSCSLLHTPFDLSVEEKLKANKPDLYSWLAFTLQKTQELRVLKA
ALNEGRDSVAEELAASQAAADSRANSSEIHRADVAKRLADLPANADQRKSPFADRIKAQQ
AWLNLPLLPTTNIGSFPQTTEIRQARSAFKKGELSAADYEAAMKKEIALVVEEQEKLDLD
VLVHGEAERNDMVEYFGELLSGFAFTQYGWVQSYGSRCVKPPIIFGDVSRPEAMTVAWST
YAQSLTKRPMKGMLTGPVTILQWSFVRNDIPRSTVCKQIALALNDEVLDLEKAGIKVIQI
DEPAIREGLPLKRADWDAYLNWAGESFRLSSAGCEDSTQIHTHMCYSEFNDILPAIAAMD
ADVITIETSRSDMELLTAFGEFQYPNDIGPGVYDIHSPRVPTEAEVEHLLRKAIEVVPVE
RLWVNPDCGLKTRGWKETLEQLQVMMNVTRKLRAELAK
NT seq 2277 nt NT seq  +upstreamnt  +downstreamnt
atgacaacattacatttctcaggcttcccgcgtgtcggcgccttccgcgaattgaaattc
gcacaagaaaaatactggcgcaaagaaatcagcgagcaagaattgctggctgttgctaaa
gacttgcgcgagaaaaactggaaacaccaggtcgctgccaacgccgatttcgttgccgta
ggcgatttcactttctacgaccacatcctcgacctgcaagtcgccaccggcgcgattccc
gcccgcttcggcttcgacagccaaaacctgtctttggaacaattcttccaactggcgcgc
ggtaacaaagaccaattcgctatcgaaatgaccaaatggttcgacaccaactaccactac
ttggtgcctgaattccacgccgataccgaattcaaagccaatgccaaacactatgttcaa
caactgcaagaagcccaagccctcggtctgaaagccaaaccgaccgttgtaggtccgttg
actttcctgtgggtgggtaaagaaaaaggcgccgtcgaattcgaccgtctgagcctgttg
cctaaactgttgcctgtttacgttgaaatcctgactgctttggttgaagccggtgccgag
tggattcaaatcgacgagcctgctttggctgtcgatttgcctaaagaatgggtggaagcc
tacaaagacgtttacgctactttgagcaaagtaagtgccaaaatcctgttgagcacttac
ttcggttctgttgccgaacacgccgcattgttgaaagccctgcctgttgacggtctgcac
atcgacttggtacgcgcccccgagcaactggacgcgttcgccgactacgacaaagtcctg
tctgccggcgtgattgacggccgcaacatttggcgcgccaacctgaacaaagttttggaa
actgtcgagcctctgcaagccaaactgggtgaccgtttgtggatttccagctcttgctcg
ctgctgcacactccatttgacttgtcagttgaagaaaaactgaaagccaacaaacccgac
ctgtactcttggttggcattcaccctgcaaaaaacccaagaattgcgcgttctgaaagct
gcattgaacgaaggccgtgattctgttgccgaagaactcgccgccagccaagctgctgcc
gactcccgtgccaacagcagcgaaatccatcgtgcagacgttgccaaacgcctggccgat
ttgcctgccaacgcagaccaacgcaaatctccatttgccgaccgtatcaaagcgcaacaa
gcatggttgaacctacctctgctaccgactaccaacatcggttctttcccgcaaaccacc
gaaatccgccaggcacgctcagccttcaaaaaaggcgaactgtctgccgccgattacgaa
gccgcgatgaaaaaagaaatcgccttggtggttgaagagcaagaaaaactggacttggac
gtactggtacacggcgaagccgagcgtaacgacatggttgaatacttcggcgaattgttg
agcggttttgcattcactcaatacggctgggtacaaagctacggctcacgctgcgtgaaa
ccaccgattatctttggcgacgtaagccgtcctgaagccatgaccgtggcttggtctact
tacgcacaaagcctgaccaaacgcccgatgaaaggtatgttgaccggccctgtaaccatt
ctgcaatggtctttcgtccgcaacgacattcctcgctctaccgtgtgcaaacaaatcgca
ctggctctgaacgacgaagtattggatctggaaaaagccggcatcaaagtcatccaaatt
gacgaacctgccatccgcgaaggcttgccgctgaaacgcgccgattgggatgcctacctg
aactgggcgggcgaatccttccgcctgtcctctgccggttgcgaagacagcacccaaatc
cacactcatatgtgttactccgagttcaacgatatcctgcctgcgattgctgcaatggat
gcggacgtgatcaccatcgagacttcacgttccgacatggaactcttgaccgcgttcggc
gaattccaatacccgaacgacatcggcccgggggtttacgacatccacagcccgcgcgta
ccgacagaagccgaagtggagcacctgttgcgcaaagccatcgaggttgtaccggttgaa
cgtctgtgggttaacccggactgcggcctgaaaacacgcggctggaaagaaactctggaa
caactccaagtaatgatgaacgtaacccgaaaactgcgtgccgaattggcgaaataa

DBGET integrated database retrieval system