KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0947Help
Entry
NMB0947           CDS       T00027                                 

Definition
(RefSeq) dihydrolipoamide dehydrogenase
  KO
K00382  
dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Glycine, serine and threonine metabolism
Valine, leucine and isoleucine degradation
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NMB0947
   00020 Citrate cycle (TCA cycle)
    NMB0947
   00620 Pyruvate metabolism
    NMB0947
   00630 Glyoxylate and dicarboxylate metabolism
    NMB0947
   00640 Propanoate metabolism
    NMB0947
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NMB0947
   00280 Valine, leucine and isoleucine degradation
    NMB0947
Enzymes [BR:nme01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     NMB0947
Exosome [BR:nme04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   NMB0947
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
960826..962229
Genome map
AA seq 467 aa AA seqDB search
MKKIQADVVVIGGGTAGMGAFRNARLHSDNVYLIENNVFGTTCARVGCMPSKLLIAAAEA
RHHALHTDPFGVHLDKDSIVVNGEEVMQRVKSERDRFVGFVVADVEEWPADKRIMGSAKF
IDEHTVQIDEHTQITAKSFVIATGSRPVILPQWQSLGNRLIINDDVFSWDTLPKRVAVFG
PGVIGLELGQALHRLGVKVEIFGLGGIIGGISDPVVSDEANAVFGEELKLHLDAKTEVKL
DADGNVEVHWEQDGEKGVFVAEYMLAAVGRRPNVDNIGLENINIEKDARGVPVADPLTMQ
TSIPHIFIAGDASNQLPLLHEAADQGKIAGDNAGRYPNIGGGLRRSTIGVVFTSPQIGFV
GLKYAQVAAQYQADEFVIGEVSFKNQGRSRVMLVNKGHMRLYAEKATGRFIGAEIVGPAA
EHLAHLLAWAHQMKMTVPQMLDMPFYHPVIEEGLRTALRDADAKLKA
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaattcaagcggatgtcgtcgtaatcggcggcggtactgccggtatgggtgcg
tttcgcaatgcccgtttacattcggataatgtttacctgattgaaaacaatgtgttcggc
acgacctgcgcgcgcgtgggctgtatgccttccaaactcttgattgccgccgcagaggcg
cgtcatcacgcattgcataccgacccgttcggcgtgcatttggacaaagacagcatcgtc
gtcaacggtgaagaggtcatgcagcgcgttaaatccgagcgtgaccgttttgtcggcttt
gtcgttgccgatgtggaagagtggcctgccgacaagcgcattatgggttcggctaaattt
atcgacgagcataccgtccaaatcgacgagcatactcaaattacggcaaaaagtttcgtg
attgctaccggttcgcgtcccgtcatcctgccgcaatggcagtctttgggcaatcgtttg
attatcaacgatgacgttttctcatgggatacgctgcctaagcgcgttgccgtgttcggg
ccgggtgttatcggtttggaactgggtcaggcattgcaccgtttgggcgtgaaagttgaa
attttcggtttgggcggaatcatcggcggcatttccgaccccgtcgtttcagacgaggcg
aacgccgtgttcggcgaagaattgaaactgcatctggatgctaaaaccgaggtcaaactc
gatgcagacggcaatgtagaagtccattgggagcaggatggcgaaaaaggcgtatttgtt
gccgaatatatgctggcagccgtgggccgccgtccgaacgttgacaatatcggtttggaa
aatatcaatatcgaaaaagatgcgcgcggcgtacctgttgccgacccgctgaccatgcag
accagtattccgcatatcttcatcgcaggcgatgcgtccaaccaactgcctctgctgcat
gaagctgccgaccaaggcaagattgccggcgataacgcgggccgctacccgaatatcggc
ggcggtttgcggcgcagcaccatcggcgtggtgtttaccagtccgcaaatcggctttgtc
ggtctgaaatacgcgcaggttgccgcgcaataccaagccgacgaatttgtcatcggcgaa
gtatcgttcaaaaaccaaggccgcagccgcgtgatgctggtgaacaaaggccatatgcgc
ctgtatgccgaaaaagccaccggccgctttatcggcgcggaaatcgtaggccctgccgcc
gaacatttggcgcacctgttggcttgggcacatcaaatgaagatgaccgttccgcaaatg
ctggatatgccgttctaccatcccgttatcgaggaaggtctgcgtaccgcgttgcgcgat
gccgatgcgaaattgaaagcctga

DBGET integrated database retrieval system