KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0949Help
Entry
NMB0949           CDS       T00027                                 

Gene name
sdhD
Definition
(RefSeq) succinate dehydrogenase hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00020  Citrate cycle (TCA cycle)
nme00190  Oxidative phosphorylation
nme00650  Butanoate metabolism
nme01100  Metabolic pathways
nme01110  Biosynthesis of secondary metabolites
nme01120  Microbial metabolism in diverse environments
nme01130  Biosynthesis of antibiotics
nme01200  Carbon metabolism
Module
nme_M00009  Citrate cycle (TCA cycle, Krebs cycle)
nme_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
nme_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NMB0949 (sdhD)
   00650 Butanoate metabolism
    NMB0949 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    NMB0949 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt Fumarate_red_C CybS
Motif
Other DBs
NCBI-GeneID: 903069
NCBI-ProteinID: NP_273987
UniProt: Q9JZP9
Position
962879..963220
Genome map
AA seq 113 aa AA seqDB search
MVERKLTGAHYGLRDWVMQRATAVIMLIYTVALLVVLFSLPKEYSAWQAFFSQTWVKVFT
QVSFIAVFLHAWVGIRDLWMDYIKPFGVRLFLQVATIVWLVGCLVYSVKVIWG
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atggtagaacgtaaattgaccggtgcccattacggtttgcgcgattgggtgatgcaacgt
gcgactgcggttattatgttgatttataccgttgcacttttagtggttctattttccctg
cctaaagaatattcggcatggcaggcattttttagtcaaacttgggtaaaagtatttacc
caagtgagcttcatcgccgtattcttgcacgcttgggtgggtatccgcgatttgtggatg
gactatatcaaacccttcggcgtgcgtttgtttttgcaggttgccaccatcgtttggctg
gtcggctgtctcgtgtattcagttaaagtgatttgggggtaa

DBGET integrated database retrieval system