KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0954Help
Entry
NMB0954           CDS       T00027                                 

Gene name
gltA
Definition
(RefSeq) type II citrate synthase
  KO
K01647  
citrate synthase [EC:2.3.3.1]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Citrate cycle (TCA cycle)
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NMB0954 (gltA)
   01210 2-Oxocarboxylic acid metabolism
    NMB0954 (gltA)
   01230 Biosynthesis of amino acids
    NMB0954 (gltA)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NMB0954 (gltA)
   00630 Glyoxylate and dicarboxylate metabolism
    NMB0954 (gltA)
Enzymes [BR:nme01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.1  citrate (Si)-synthase
     NMB0954 (gltA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
966177..967460
Genome map
AA seq 427 aa AA seqDB search
MSKSIKLNVPGQAGLELPVLEASIGHDVVDIRGLTKNTGLFSFDPGFVSTASCESKITYI
DGDQGLLYYRGYPIEQLAEKSDYLEVCYLLIYGELPTPEQKAEFDNTVRRHTMVHEQLTW
FFRGFRRDAHPMAMMVGVVGALSAFYQDSLDISNPEHRKIAIYRLISKIPTIAAMCYRYS
NGLPFNYPKNNLSYSENFLHMMFATPCEDYKPNPVLARALDRIFILHADHEQNASTSTVR
LAGSSGANPFACIAAGIACLWGASHGGANEAVLKMLDEIGDVSNVAAYMEGVKQRKYRLM
GFGHRVYRNMDPRASIMRETCYEVLKELGLEDSPKFKLAMELEQIALKDPFFIERKLYPN
VDFYSGIVLSALGIPTEMFTVIFALSRSVGWISHWHEMISDPSLKIGRPRQLYTGSERRD
YVPPGER
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaatcaatcaaactcaacgtaccgggtcaggcaggtttggagctgccggtattg
gaagccagcatcgggcacgatgtggttgacattcgggggctgacaaaaaatacaggtttg
ttttccttcgaccccggatttgtttcaaccgcaagctgtgagtctaaaattacttacatc
gacggcgatcaaggcttgctttattatcgcggataccccatcgagcagctggccgaaaag
tccgattatttggaagtctgctacctgttgatttacggcgaactgccgactcccgagcaa
aaggcagaatttgacaataccgtccgccgccacacgatggtgcatgaacagctgacttgg
ttcttccgggggttccgccgcgacgcgcatccgatggcgatgatggtcggcgtggtcggc
gcactgtctgcgttctaccaagacagcttggacattagcaatcccgaacaccgcaaaatc
gcgatttaccgcctgatttctaaaatcccgaccattgcggcaatgtgctaccgctattca
aacggtctgccgttcaattatccgaagaataatctttcttattccgaaaacttccttcat
atgatgttcgccacgccgtgtgaagactacaaacccaatcccgttttggcacgcgcgctc
gaccgcatctttattttgcatgccgaccacgagcaaaacgcctcaacttcaaccgtccgt
ctggcagggtcttcgggtgcgaacccgtttgcctgtattgctgccggtatcgcctgcctg
tggggtgcttcgcacggcggtgcgaacgaagccgtgttgaaaatgttggacgaaatcggc
gatgtgtctaatgttgccgcatacatggaaggtgtgaaacaacgcaaataccgtctgatg
ggcttcggtcaccgcgtgtaccgcaatatggatccgcgtgccagcattatgcgcgaaacc
tgctatgaagttttgaaggaattgggcttggaagacagtccgaaattcaaactggcgatg
gaattggaacagattgcgctgaaagacccgttctttatcgaacgcaaactgtatccaaac
gtcgatttctattccggcatcgtcctgtccgcgctgggcatcccgaccgaaatgtttacc
gtcatcttcgccctgtcgcgcagcgtgggctggatttcgcactggcacgagatgattagc
gatccttcgctgaaaatcggccgcccgcgccagctttataccggttcggaacgccgcgat
tatgtgccgccaggcgagaggtaa

DBGET integrated database retrieval system