KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0954Help
Entry
NMB0954           CDS       T00027                                 

Gene name
gltA
Definition
(RefSeq) type II citrate synthase
  KO
K01647  citrate synthase [EC:2.3.3.1]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00020  Citrate cycle (TCA cycle)
nme00630  Glyoxylate and dicarboxylate metabolism
nme01100  Metabolic pathways
nme01110  Biosynthesis of secondary metabolites
nme01120  Microbial metabolism in diverse environments
nme01130  Biosynthesis of antibiotics
nme01200  Carbon metabolism
nme01210  2-Oxocarboxylic acid metabolism
nme01230  Biosynthesis of amino acids
Module
nme_M00009  Citrate cycle (TCA cycle, Krebs cycle)
nme_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NMB0954 (gltA)
   00630 Glyoxylate and dicarboxylate metabolism
    NMB0954 (gltA)
Enzymes [BR:nme01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.1  citrate (Si)-synthase
     NMB0954 (gltA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Citrate_synt ERbeta_N
Motif
Other DBs
NCBI-GeneID: 903074
NCBI-ProteinID: NP_273992
UniProt: Q7DDK0
Position
966177..967460
Genome map
AA seq 427 aa AA seqDB search
MSKSIKLNVPGQAGLELPVLEASIGHDVVDIRGLTKNTGLFSFDPGFVSTASCESKITYI
DGDQGLLYYRGYPIEQLAEKSDYLEVCYLLIYGELPTPEQKAEFDNTVRRHTMVHEQLTW
FFRGFRRDAHPMAMMVGVVGALSAFYQDSLDISNPEHRKIAIYRLISKIPTIAAMCYRYS
NGLPFNYPKNNLSYSENFLHMMFATPCEDYKPNPVLARALDRIFILHADHEQNASTSTVR
LAGSSGANPFACIAAGIACLWGASHGGANEAVLKMLDEIGDVSNVAAYMEGVKQRKYRLM
GFGHRVYRNMDPRASIMRETCYEVLKELGLEDSPKFKLAMELEQIALKDPFFIERKLYPN
VDFYSGIVLSALGIPTEMFTVIFALSRSVGWISHWHEMISDPSLKIGRPRQLYTGSERRD
YVPPGER
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaatcaatcaaactcaacgtaccgggtcaggcaggtttggagctgccggtattg
gaagccagcatcgggcacgatgtggttgacattcgggggctgacaaaaaatacaggtttg
ttttccttcgaccccggatttgtttcaaccgcaagctgtgagtctaaaattacttacatc
gacggcgatcaaggcttgctttattatcgcggataccccatcgagcagctggccgaaaag
tccgattatttggaagtctgctacctgttgatttacggcgaactgccgactcccgagcaa
aaggcagaatttgacaataccgtccgccgccacacgatggtgcatgaacagctgacttgg
ttcttccgggggttccgccgcgacgcgcatccgatggcgatgatggtcggcgtggtcggc
gcactgtctgcgttctaccaagacagcttggacattagcaatcccgaacaccgcaaaatc
gcgatttaccgcctgatttctaaaatcccgaccattgcggcaatgtgctaccgctattca
aacggtctgccgttcaattatccgaagaataatctttcttattccgaaaacttccttcat
atgatgttcgccacgccgtgtgaagactacaaacccaatcccgttttggcacgcgcgctc
gaccgcatctttattttgcatgccgaccacgagcaaaacgcctcaacttcaaccgtccgt
ctggcagggtcttcgggtgcgaacccgtttgcctgtattgctgccggtatcgcctgcctg
tggggtgcttcgcacggcggtgcgaacgaagccgtgttgaaaatgttggacgaaatcggc
gatgtgtctaatgttgccgcatacatggaaggtgtgaaacaacgcaaataccgtctgatg
ggcttcggtcaccgcgtgtaccgcaatatggatccgcgtgccagcattatgcgcgaaacc
tgctatgaagttttgaaggaattgggcttggaagacagtccgaaattcaaactggcgatg
gaattggaacagattgcgctgaaagacccgttctttatcgaacgcaaactgtatccaaac
gtcgatttctattccggcatcgtcctgtccgcgctgggcatcccgaccgaaatgtttacc
gtcatcttcgccctgtcgcgcagcgtgggctggatttcgcactggcacgagatgattagc
gatccttcgctgaaaatcggccgcccgcgccagctttataccggttcggaacgccgcgat
tatgtgccgccaggcgagaggtaa

DBGET integrated database retrieval system