KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0957Help
Entry
NMB0957           CDS       T00027                                 

Gene name
lpdA1
Definition
(RefSeq) dihydrolipoamide dehydrogenase
  KO
K00382  
dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Glycine, serine and threonine metabolism
Valine, leucine and isoleucine degradation
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NMB0957 (lpdA1)
   00020 Citrate cycle (TCA cycle)
    NMB0957 (lpdA1)
   00620 Pyruvate metabolism
    NMB0957 (lpdA1)
   00630 Glyoxylate and dicarboxylate metabolism
    NMB0957 (lpdA1)
   00640 Propanoate metabolism
    NMB0957 (lpdA1)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NMB0957 (lpdA1)
   00280 Valine, leucine and isoleucine degradation
    NMB0957 (lpdA1)
Enzymes [BR:nme01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     NMB0957 (lpdA1)
Exosome [BR:nme04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   NMB0957 (lpdA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
972139..973572
Genome map
AA seq 477 aa AA seqDB search
MSQYDVVVIGAGPGGYVAAIRAAQLGFKTACVDAGVNKAGNAPALGGTCLNVGCIPSKAL
LQSSEHFHAAQHEFAEHGITVGDVKFDAAKMIERKDAIVTKLTGGVKFLFQKNKVTSLFG
TASFAGKNGDAYQIEVDNKGEKTVIEAKHVIVATGSVPRPLPQVAIDNVNVLDNEGALNL
TEVPAKLGVIGSGVIGLEMGSVWNRVGAEVTILEAAPTFLAAADQQIAKEAFKYFTKEQG
LSIELGVKIGDIKSEGKGVSVAYETAAGEAKTEVFDKLIVAIGRIPNTKGLNAEAVGLEK
DERGFIKVDGECRTNLPNVWAIGDVVRGPMLAHKASDEGVAVAERIAGQKPHIDFNNVPF
VIYTDPEIAWVGKTEEQLKAEGVEYKKGTSGFGANGRALAMGKAKGTVKVLADAKTDRIL
GVHMIGPVVSELVTEGVTALEFFASSEDIARIIHAHPTLSEVVHEAALAADKRALHG
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaatatgatgtagtagtgattggtgcaggcccgggtggatacgttgccgccatc
cgtgccgcgcaactgggtttcaaaaccgcttgcgtcgatgcaggcgttaacaaagcaggc
aatgcccctgcattgggcggtacttgcttgaacgtaggctgtatcccttctaaagccctg
ttgcaatccagcgaacatttccacgctgcgcaacacgagtttgccgaacacggtatcact
gtcggcgacgtaaaattcgacgcggccaaaatgattgagcgcaaagatgccatcgtgacc
aagctgaccggcggcgtcaaattcctgttccaaaaaaataaagtaaccagcctgttcggt
acggcttcctttgccggtaaaaatggcgatgcttaccaaatcgaagtcgataacaaaggc
gagaaaaccgttatcgaagccaaacacgtcatcgtagccaccggttccgtaccgcgtccg
ctgccacaagtcgctatcgacaatgtgaacgtattggacaacgaaggtgcattgaacctg
accgaagtacctgccaaactcggcgtgatcggttccggcgtgattggtttggaaatgggt
tccgtatggaaccgcgtgggtgcggaagttaccattcttgaagccgcgccgactttcctg
gctgccgccgaccaacaaatcgccaaagaagccttcaaatacttcaccaaagagcaaggt
ctgagcatcgaattgggcgtgaaaatcggcgacatcaagtctgaaggcaaaggtgtttcc
gttgcttacgaaactgctgctggcgaagccaaaaccgaagtattcgacaaactgatcgtt
gccatcggccgtattccaaacaccaaaggcctgaacgcggaagccgtaggcttggaaaaa
gacgagcgcggctttatcaaagtagatggcgaatgccgtaccaacctgcctaacgtatgg
gcaatcggcgacgtggttcgcggcccgatgttggcacacaaagccagcgacgaaggcgtt
gccgttgccgaacgcattgccggtcaaaaaccgcatatcgacttcaacaacgtaccgttc
gtgatttacaccgatcctgaaatcgcttgggtgggtaaaaccgaagagcagctcaaagcc
gaaggcgtggagtacaaaaaaggtacttcaggttttggtgcgaatggtcgcgcattggca
atgggcaaagccaaaggtacggttaaagtgttggcagatgccaaaaccgaccgcatcttg
ggcgtacacatgattggtccggttgtcagcgaattggttaccgaaggcgtgactgcgctc
gaattcttcgccagcagcgaagacatcgcccgcattatccatgcccacccaaccttgtcc
gaagtggttcacgaagctgcattggcggccgacaaacgcgctttgcacggttga

DBGET integrated database retrieval system