KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0963Help
Entry
NMB0963           CDS       T00027                                 

Definition
(RefSeq) phosphatidylserine decarboxylase
  KO
K01613  
phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    NMB0963
Enzymes [BR:nme01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     NMB0963
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
981343..982140
Genome map
AA seq 265 aa AA seqDB search
MNRLYPHPIIAREGWPIIGGGLALSLLVSICCGWWSLPFWVFTVFALQFFRDPAREIPLN
PEAVLSPVDGRIVVVERARDPYRDVDALKISIFMNVFNVHSQKSPADCTVTKVVYNKGKF
VNADLDKASTENERNAVLATTASGREITFVQVAGLVARRILCYTQAGAKLSRGERYGFIR
FGSRVDMYLPVDAQAQVAIGDKVTGVSTVLARLPLTAPQTESEPESEPALQTAPVETAAN
PSAEQRQIEAAAAKIQAAVQDVLKD
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgtctttacccccacccgattatcgcccgtgagggctggccgattattggcggc
ggtttggctttgagcctgctggtgtcgatatgttgcggctggtggtctttgccgttttgg
gtgtttaccgtatttgcattgcagtttttccgcgaccctgcgcgtgagattccgctaaat
cctgaagcggtgttgagcccggttgacggccgtatcgtggtggtcgaacgcgcacgcgat
ccgtatcgtgatgtcgatgctttgaaaatcagtatttttatgaacgtgttcaacgtgcat
tcgcaaaaatcgcctgccgattgtacggtaacgaaagtggtctataacaaaggcaaattc
gtgaatgcggatttggacaaagccagcacggaaaacgaacgtaatgcggtgttggcgact
acggcttcaggtcgtgaaattacttttgttcaagtggccggtttggtggcgcgccgtatt
ttgtgctacacccaagcaggtgcgaaactgtcccgcggcgaacgttatggctttatccgc
ttcggttcgcgcgtggatatgtatctgcctgtcgatgcgcaggcgcaagtggcgattggc
gataaagtaaccggcgtcagcactgtattggcgcgtttgccgctgactgcgccgcaaact
gaatctgagcctgaatctgagcctgctttacaaactgctccggttgaaacagcggcaaac
ccatctgccgaacaacggcaaatcgaggcagcggcggctaagattcaggcggctgtgcaa
gatgtgttgaaagattaa

DBGET integrated database retrieval system