KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0967Help
Entry
NMB0967           CDS       T00027                                 

Gene name
trpD
Definition
(RefSeq) anthranilate phosphoribosyltransferase
  KO
K00766  
anthranilate phosphoribosyltransferase [EC:2.4.2.18]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NMB0967 (trpD)
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NMB0967 (trpD)
Enzymes [BR:nme01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.18  anthranilate phosphoribosyltransferase
     NMB0967 (trpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
986617..987675
Genome map
AA seq 352 aa AA seqDB search
MITPQQAIERLISNNELFYDEMTDLMRQIMRGQVLPEQIAAILTGLRIKVETVSEITAAA
AVMREFATKVPLENAEGLVDIVGTGGDGAKTFNISTTSMFVAAAAGAKVAKHGGRSVSSS
SGAADVVEQMGANLNLTPEQVAQSIRQTGIGFMFAPNHHSAMRHVAPVRRSLGFRSIFNI
LGPLTNPAGAPNQLLGVFHTDLCGILSRVLQQLGSKHVLVVCGEGGLDEITLTGKTRVAE
LKDGKISEYDIRPEDFGIETRRNLDEIKVANTQESLLKMNEVLEGREGAARDIVLLNTAA
ALYAGNVAASLSDGISAAREAIDSGRAKSKKEEFVGFQPQQRCHFLGKMELG
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgattacaccgcaacaggccatcgaacgattaatcagcaataacgagttgttttacgat
gaaatgaccgacttgatgcgtcagattatgagaggacaggttctgccggagcagatagcg
gccattttgacaggattgcgtatcaaggttgaaaccgtttccgaaattaccgcagctgca
gccgtcatgcgcgagtttgcgacaaaagtgccgctggagaatgcagaggggctggtcgat
atcgtcggtacgggcggggatggcgcgaaaaccttcaatatttcgacgacttcgatgttt
gttgccgcagcggcaggcgcgaaggttgccaaacacggaggccggtcggtctcttcctcc
agcggtgcggctgacgtggtggagcagatgggcgcaaacctcaacctgactcccgaacag
gttgcccaaagtatcaggcagaccggcatcgggtttatgttcgcgcccaatcaccacagt
gccatgcgccatgtcgcccctgtacgccgttcgctcggtttccgaagtattttcaacata
ttgggtccgttaacgaatcctgcgggcgcgccgaaccagcttttgggcgtgttccacacc
gatttgtgcggcattttgtcgcgggtcttgcaacaacttggttcaaaacacgttttggtt
gtttgcggggagggcggtttggatgaaattacactgacgggcaaaacacgcgttgccgag
ctcaaagacggaaaaatcagcgaatacgacatccgcccagaagatttcggtatcgaaacc
cgccgcaatttggatgaaatcaaagttgccaatactcaggaatctttgttgaaaatgaat
gaggtgctggaaggaagagaaggggctgcgcgcgatatcgtattgctcaacaccgccgcc
gccctgtatgccggaaatgtcgctgcttcgctttcagacggcatatctgccgcacgggaa
gccatcgattcaggcagggccaaatcgaaaaaagaggagtttgtcggttttcaaccacaa
caaagatgccattttcttggaaagatggagcttgggtga

DBGET integrated database retrieval system