KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0967Help
Entry
NMB0967           CDS       T00027                                 

Gene name
trpD
Definition
(RefSeq) anthranilate phosphoribosyltransferase
  KO
K00766  anthranilate phosphoribosyltransferase [EC:2.4.2.18]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00400  Phenylalanine, tyrosine and tryptophan biosynthesis
nme01100  Metabolic pathways
nme01110  Biosynthesis of secondary metabolites
nme01130  Biosynthesis of antibiotics
nme01230  Biosynthesis of amino acids
Module
nme_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NMB0967 (trpD)
Enzymes [BR:nme01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.18  anthranilate phosphoribosyltransferase
     NMB0967 (trpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_3 Glycos_trans_3N
Motif
Other DBs
NCBI-GeneID: 903087
NCBI-ProteinID: NP_274005
UniProt: P66995
Position
986617..987675
Genome map
AA seq 352 aa AA seqDB search
MITPQQAIERLISNNELFYDEMTDLMRQIMRGQVLPEQIAAILTGLRIKVETVSEITAAA
AVMREFATKVPLENAEGLVDIVGTGGDGAKTFNISTTSMFVAAAAGAKVAKHGGRSVSSS
SGAADVVEQMGANLNLTPEQVAQSIRQTGIGFMFAPNHHSAMRHVAPVRRSLGFRSIFNI
LGPLTNPAGAPNQLLGVFHTDLCGILSRVLQQLGSKHVLVVCGEGGLDEITLTGKTRVAE
LKDGKISEYDIRPEDFGIETRRNLDEIKVANTQESLLKMNEVLEGREGAARDIVLLNTAA
ALYAGNVAASLSDGISAAREAIDSGRAKSKKEEFVGFQPQQRCHFLGKMELG
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgattacaccgcaacaggccatcgaacgattaatcagcaataacgagttgttttacgat
gaaatgaccgacttgatgcgtcagattatgagaggacaggttctgccggagcagatagcg
gccattttgacaggattgcgtatcaaggttgaaaccgtttccgaaattaccgcagctgca
gccgtcatgcgcgagtttgcgacaaaagtgccgctggagaatgcagaggggctggtcgat
atcgtcggtacgggcggggatggcgcgaaaaccttcaatatttcgacgacttcgatgttt
gttgccgcagcggcaggcgcgaaggttgccaaacacggaggccggtcggtctcttcctcc
agcggtgcggctgacgtggtggagcagatgggcgcaaacctcaacctgactcccgaacag
gttgcccaaagtatcaggcagaccggcatcgggtttatgttcgcgcccaatcaccacagt
gccatgcgccatgtcgcccctgtacgccgttcgctcggtttccgaagtattttcaacata
ttgggtccgttaacgaatcctgcgggcgcgccgaaccagcttttgggcgtgttccacacc
gatttgtgcggcattttgtcgcgggtcttgcaacaacttggttcaaaacacgttttggtt
gtttgcggggagggcggtttggatgaaattacactgacgggcaaaacacgcgttgccgag
ctcaaagacggaaaaatcagcgaatacgacatccgcccagaagatttcggtatcgaaacc
cgccgcaatttggatgaaatcaaagttgccaatactcaggaatctttgttgaaaatgaat
gaggtgctggaaggaagagaaggggctgcgcgcgatatcgtattgctcaacaccgccgcc
gccctgtatgccggaaatgtcgctgcttcgctttcagacggcatatctgccgcacgggaa
gccatcgattcaggcagggccaaatcgaaaaaagaggagtttgtcggttttcaaccacaa
caaagatgccattttcttggaaagatggagcttgggtga

DBGET integrated database retrieval system