KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0978Help
Entry
NMB0978           CDS       T00027                                 

Gene name
pntB
Definition
(RefSeq) pyridine nucleotide transhydrogenase
  KO
K00325  
NAD(P) transhydrogenase subunit beta [EC:1.6.1.2]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    NMB0978 (pntB)
Enzymes [BR:nme01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.1  With NAD+ or NADP+ as acceptor
    1.6.1.2  NAD(P)+ transhydrogenase (Re/Si-specific)
     NMB0978 (pntB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
complement(992395..993780)
Genome map
AA seq 461 aa AA seqDB search
MSSGLVTAAYIVAAILFIFSLAGLSKQETAKQGCYSGIAGMAVALFVTVFSDNTHGLGWI
IIAMLIGAAIGIYKAKKVEMTEMPELIALLHSFVGLAAVLVGFNSYIAPGNVSHDMHTIH
LVEVYLGIFIGAVTFTGSLVAFGKLNGKISSSPLQLPAKHKLNALALAVSFVLLLVFVGI
DGSGFILLIMTLIALAFGWHLVASIGGADMPVVVSMLNSYSGWAAAAAGFMLSNDLLIVT
GALVGSSGAILSYIMCKAMNRSFVSVIAGGFGSDSGTLSSGSQEIGEYREVKAADIAEML
KGANNVIITPGYGMAVAQAQYPVAEITELLRKNGTEVRFGIHPVAGRLPGHMNVLLAEAK
VPYDIVLEMDEINDDFPETDVVLVIGANDTVNPAAQTDPNSPIAGMPVLEVWKAKEVVVF
KRSMNTGYAGVQNPLFFNENSVMCFGDAKKTVDDILSELKK
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcaggactcgtaacagcggcgtatatcgttgccgcaattttattcatcttctca
ctggcggggctgtccaaacaggaaaccgccaaacagggctgctattccggtatcgccggt
atggcggtcgccctttttgtaactgttttttccgacaatacccacggactgggctggatc
atcatcgccatgctcatcggcgcggcaatcggcatctacaaagccaaaaaggtggaaatg
accgaaatgcccgaactgattgccctgctgcacagcttcgtcggcctagcggcggttttg
gtcggcttcaacagctatatcgcgccgggcaacgtttcgcacgatatgcacaccatccat
ctggtcgaagtgtatttaggcatcttcatcggcgcggtaacctttaccggctcgctggtc
gcattcggcaaactcaacggcaaaatcagcagcagcccgctgcaactgcccgccaaacac
aagctcaacgcactggcacttgccgtatcgtttgtgttgctgctcgtatttgtcggcatt
gacggcagcggcttcatcctgctgattatgaccctgattgccctcgcattcggctggcac
ttggttgcctccatcggcggcgcagatatgcccgtggtcgtgtccatgctcaactcctac
tccggctgggcggccgcagcggcaggcttcatgctctccaacgacctgctcatcgttacc
ggcgcgctggtcggctcaagcggcgcgattctgtcctacattatgtgcaaagccatgaac
cgctcgtttgtctcggtaattgccggtggtttcggcagcgacagcggcacattatcttcc
ggcagccaagagataggggaataccgagaagtcaaagctgccgatattgccgaaatgctg
aaaggcgcaaacaatgtcatcattaccccgggctacggtatggcagtcgcacaagcgcaa
taccccgttgccgaaatcaccgagcttttacgtaaaaacggcaccgaagtacgcttcggc
atccaccccgtcgccggccgcctgcccggtcatatgaacgtactgctcgccgaagccaaa
gtcccctacgacatcgttttggaaatggacgaaatcaacgacgacttccccgaaaccgat
gtggtcttggtcatcggtgcgaacgacaccgtcaaccccgccgcccaaaccgacccgaac
agcccgattgcgggtatgcccgtgttggaagtgtggaaggcaaaagaagtcgtcgtcttc
aaacgctcgatgaataccggctacgcaggtgtacaaaacccactgttcttcaacgaaaac
agcgtgatgtgtttcggagatgcgaagaaaaccgtagatgacattctgtccgaactgaaa
aaataa

DBGET integrated database retrieval system