KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0981Help
Entry
NMB0981           CDS       T00027                                 

Gene name
serB
Definition
(RefSeq) phosphoserine phosphatase
  KO
K01079  
phosphoserine phosphatase [EC:3.1.3.3]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NMB0981 (serB)
   01230 Biosynthesis of amino acids
    NMB0981 (serB)
  Energy metabolism
   00680 Methane metabolism
    NMB0981 (serB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NMB0981 (serB)
Enzymes [BR:nme01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.3  phosphoserine phosphatase
     NMB0981 (serB)
Protein phosphatases and associated proteins [BR:nme01009]
 HAD phosphatases
  Other HAD phosphatases
   NMB0981 (serB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
996078..996911
Genome map
AA seq 277 aa AA seqDB search
MPHALVLQFPSAAALPSDFPLRLPEPDCADEKRMRFIVEEGFSLSEKDAALLGSRQIDHA
VLPDMDFDELGLIVSDMDSTLITIECVDEIAAGVGLKNKVAEITERSMRGELDFEQSLRS
RVALLAGLDERVLADVYENVLKLSPGAEFLLDECKRHDVKFLLVSGGFTFFTERLQQRLG
FEYQHANVLEIENGRLTGRLKGRIIDAQAKADLLREYRSRLGLQPHQVLAVGDGANDIPM
LKEAGIGVAYRAKPKARAAADACINFGGLERVRGLFG
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgccgcacgccctcgtcctccaatttccctccgccgcagccctgccttccgacttcccc
ttacgcctgcccgaacctgattgcgccgatgaaaagcgtatgcgttttatcgttgaagaa
gggttttctttaagcgaaaaagacgcggcgttgcttggcagccgtcaaatcgaccacgcc
gtgttgccggatatggatttcgacgaactcggtttgattgtcagcgatatggattcgacg
ctgattaccatcgaatgcgtcgatgaaattgcggcaggcgtgggtttaaaaaacaaagta
gcggaaattaccgagcgttcgatgcgcggcgaactcgatttcgaacagtctttacgcagc
cgcgtcgcgctgttggcgggattggacgaacgggttttggcggacgtttatgaaaacgtt
ttgaagctctcgcccggtgcggaatttttgttggacgaatgcaaaaggcacgatgtgaaa
ttcctgctggtgtcgggcggcttcacgttttttaccgaaaggctgcaacaacgcctcggc
ttcgaataccaacacgccaatgttttggaaattgaaaacggcaggctgaccggccgtctg
aaaggcagaatcatcgacgcgcaggcaaaggcagatttgttgcgcgaataccgcagccgc
ctcggattgcagccgcatcaggtgttggcggtgggcgacggtgcgaacgatattccgatg
ctcaaagaagcgggcataggcgtggcttaccgtgccaaaccgaaagcgcgggccgccgcc
gatgcctgtatcaacttcggcggtttggagcgtgtacgcggcctgttcggatag

DBGET integrated database retrieval system