KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0998Help
Entry
NMB0998           CDS       T00027                                 

Definition
(RefSeq) oxidoreductase
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
1014959..1018792
Genome map
AA seq 1277 aa AA seqDB search
MTTTTAPQRIREIPYNYTSYTDREIVIRLLGDEAWQILQDLRGQRKTGRSARMLFEVLGD
IWVVVRNPYLVDDLLEHPKRRAALVREMRHRLNEIRKRRDDNRQVDVLVAAAEKAVERFD
SSFDETSQKRRQILERLSKITKPHNIMFDGLARVTHVTDATDWRVEYPFVVVNPDTEAEI
APLVRALIELDLVIIPRGGGTGYTGGAIPLDANSAVINTEKLDKHRGVEYVELAGLDGKH
PIIRCGAGVVTRRVEETAHQAGLVFAVDPTSADASCVGGNVAMNAGGKKAVLWGTALDNL
AYWNMVNPQGEWLRIERVRHNFGKIHDEETAVFDVHTLDSDGINIVKTERLEIPGHKFRK
VGLGKDVTDKFLSGLPGVQKEGTDGIITSVAFVLHKMPKYTRTVCMEFFGTVATATPSIV
EIRDFLLAHESVRLAGLEHLDWRYVRAVGYATKAAGKGRPKMVLLADVVSDDEAAVEAAA
EHICELARARDGEGFIAVSPEARKTFWLDRSRTAAIAKHTNAFKINEDVVIPLERLGEYS
DGIERINIELSIQNKLKLCAALEQYLSGKLPIDKMGTDLPTAELLGERGKHALAHVSAVK
TRWEWLLANLDTPLADYKARYGAAVHAAPEAKNNESCFIAFRDFRLRVSVKADVMKPLSE
IFSGKTDTKIIQGLGKIHAKTVRSRVFVALHMHAGDGNVHTNIPVNSDDAEMLQTAYRSV
ERIMKIARSLNGVISGEHGIGITKLEFLSDEEMQPFWDYKNQVDPKHTFNRHKLMKGSDL
RNAYTPSFELLGAESLIMEKSNLGTIADSVKDCLRCGKCKPVCSTHVPRANLLYSPRNKI
LGVGLLIEAFLYEEQTRRGVSIKHFEELMDIGDHCTVCHRCVKPCPVNIDFGDVTVAVRN
YLADSGHKRFAPAAAMGMAFLNATGPKTIKALRAAMIQIGFPAQNFAYKIGKLLPIGTKK
QKAEPKATVGKAPIKEQVIHFINRPLPKNVPAKTPRSLLGIEDGKSIPIIRNPAAPEDAE
AVFYFPGCGSERLFSQIGLAVQAMLWHVGVQTVLPPGYMCCGYPQDAGGNKAKAEEMSTN
NRVAFHRMANTLNYLDIKTVVVSCGTCYDQLEKYRFEEIFPGCRIIDIHEYLLEKGVKLD
GVKGQQYLYHDPCHTPIKTMNATQMASSLMGQKVVLSDRCCGESGMFAVKRPDIATQVKF
RKQEEIEKNLKELPQGEPVKMLTSCPACLQGLSRYADDNNMPADYIVIEMAKYILGENWL
DEFVKKANNGGVEKVLL
NT seq 3834 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgactaccgcccctcagcgtattcgggaaatcccctacaactatacttcctac
accgaccgcgaaatcgtcatccgattattgggcgacgaagcgtggcaaatcctgcaagac
ctgcgcggtcaacgcaaaaccgggcgttcggcgcggatgctgtttgaagtgttgggtgat
atttgggtggtcgtgcgcaatccgtatctggtcgatgacttgctggagcacccaaaacgc
cgcgccgcgctggtacgtgaaatgcgccaccgcttaaatgaaatccgcaaacgccgcgac
gataatcggcaagtggatgtgttggttgccgcagcagaaaaagcagtcgagcgttttgat
agcagttttgatgaaaccagccaaaaacggcggcagattttggagcgtttgagcaaaatc
accaagccgcacaatattatgttcgacgggctggcgcgggtaacgcacgttaccgatgca
accgactggcgcgtggagtatccgtttgtcgtcgtcaatcccgacacggaggctgaaatc
gcgcctttggtgcgcgccttaatcgagctggatttggtcattattccgcgcggcggcggc
acgggttataccggcggcgcgattcctttggacgcaaacagcgcagtcatcaataccgaa
aaactcgacaagcatcgtggtgttgaatacgttgagctggcaggcttggacggcaagcat
ccgattatccggtgcggcgcgggcgtggttacgcggcgggtggaagaaaccgcgcatcag
gcaggtttggtgttcgccgtcgatccgacttctgccgacgcgtcatgcgtgggcggtaat
gtggcgatgaacgcgggcggcaaaaaagccgtgctgtgggggacggcgttggacaacctc
gcctactggaacatggttaaccctcaaggcgaatggctgcgtatcgagcgcgtgcgccac
aatttcggcaaaatccacgacgaagaaaccgccgtgttcgacgttcacacgctggattca
gacggcatcaatatcgttaaaaccgaacgcttggaaatccccggccacaaattccgcaaa
gtcggtttgggcaaagacgttaccgacaaattcttgagcggcctgcccggcgtgcaaaaa
gaaggtacagacggcatcatcaccagcgttgccttcgtgttgcataaaatgccgaaatac
acgcgcaccgtgtgtatggagtttttcggtacggtcgccaccgccacgccatctattgtc
gaaatccgcgactttttgcttgcccatgaaagcgtgcggctggcgggtttggaacatttg
gactggcgttatgtccgcgccgtcggctacgccaccaaagcggcgggcaagggacgaccg
aaaatggttttgctggcagacgtggtttcagacgacgaagccgccgtagaggcagccgcc
gaacacatctgtgaactcgcacgcgcccgcgacggcgaaggctttatcgccgtatcgccc
gaagcccgcaaaaccttctggctcgaccgcagccgcaccgccgccatcgccaaacatacc
aacgcctttaaaatcaacgaagacgtggtcatcccgctcgaaaggctcggcgagtattcg
gacggcatcgaacgcatcaacattgagctttccatccaaaacaagctcaaactctgtgcc
gccttggagcaatatctttcgggcaaactccccatcgacaaaatgggcactgacctgccg
accgccgaactgttgggcgaacgcggcaaacacgccctggcccacgtttccgccgtcaaa
acgcgttgggaatggctgctcgccaatcttgacacgccgcttgccgactacaaagcccgc
tacggcgcagccgtccacgccgcacccgaagccaaaaacaatgaaagctgctttattgcc
ttccgcgatttccgcctgcgcgtgtctgtcaaagcggacgtaatgaaaccgctttctgaa
atcttcagcggcaaaaccgacaccaaaattatccaaggcttgggaaaaatccacgcaaaa
accgtacgcagccgcgtctttgtcgccctgcatatgcacgccggcgacggtaacgttcac
accaatattccggttaactcagacgatgccgaaatgcttcagacggcataccgctcagtc
gaacgcattatgaaaatcgcccgttcgcttaacggcgtgatttccggcgaacacggcatc
ggcattaccaagctcgaatttttaagcgacgaagaaatgcagccgttttgggactacaaa
aaccaagtcgatccgaaacacaccttcaaccgtcacaaactgatgaaaggctcggactta
cgcaacgcctacacgccgtccttcgagctgttgggcgcggaatcgctgattatggaaaaa
tcaaacctcggcacgattgccgattccgtcaaagactgcctgcgctgcggcaaatgcaaa
cccgtctgctctactcacgttccgcgtgccaacctgctgtacagcccccgcaacaaaatc
ctcggcgtgggcttattgatcgaagccttcttatacgaagaacaaacccgccgcggcgtt
tccatcaaacactttgaagaactcatggacatcggcgaccactgcaccgtgtgccaccgc
tgcgtcaaaccctgccccgtcaacatcgacttcggcgacgttaccgtagccgtccgcaac
tatcttgccgattccggccacaaacgatttgcgcctgccgcagctatgggtatggcgttt
ttgaacgccaccggcccgaaaaccatcaaagcccttcgcgccgccatgatacagatcggc
ttcccagcgcagaatttcgcctacaaaatcggcaaacttcttccaatcggcacgaaaaag
caaaaagccgaacccaaggcaaccgtcggcaaagccccgattaaagaacaggttatccat
ttcatcaaccgcccactgcccaaaaacgtacccgccaaaacaccgcgctccttattgggc
atcgaagacggcaaaagcatccccatcatccgcaaccccgccgcgcccgaagatgccgaa
gccgtgttctacttcccgggttgcggctctgagcgtctgttcagccaaatcggacttgcc
gttcaagccatgctctggcacgtcggcgtacaaaccgtcctgccgcccggctatatgtgt
tgcggctatccgcaagacgcaggcggcaataaggcaaaagccgaagaaatgagcaccaac
aaccgcgtggctttccaccgtatggcgaacaccctcaactacctcgacatcaaaaccgtc
gtcgtcagttgcggcacttgttacgaccagctcgaaaaataccgctttgaagaaatcttc
cccggctgccgaatcatcgacatccacgaatacctgctcgaaaaaggcgtgaaactcgac
ggcgtaaaaggtcagcaatacctctaccacgacccctgccatacccccatcaaaaccatg
aacgccacccaaatggccagcagcctgatggggcagaaagtcgttttaagcgaccgctgc
tgcggcgaatccggtatgtttgccgtcaaacggccagacatcgccactcaggtcaagttc
cgcaaacaagaggaaatcgagaaaaacctcaaagagctgccgcagggcgaacccgtcaaa
atgctgacctcctgccccgcctgcctgcaaggcttgagccgctacgccgacgacaacaat
atgcctgccgactacatcgtcatcgaaatggcgaaatacatcctcggcgaaaactggctg
gatgagtttgtaaaaaaagccaacaacggcggtgtagagaaagtgttgctgtaa

DBGET integrated database retrieval system