KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1029Help
Entry
NMB1029           CDS       T00027                                 

Gene name
aspA
Definition
(RefSeq) aspartate ammonia-lyase
  KO
K01744  
aspartate ammonia-lyase [EC:4.3.1.1]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    NMB1029 (aspA)
Enzymes [BR:nme01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.1  Ammonia-lyases
    4.3.1.1  aspartate ammonia-lyase
     NMB1029 (aspA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
complement(1043182..1044579)
Genome map
AA seq 465 aa AA seqDB search
MTVRIEHDLLGDREIPAEVYWGIHTLRAIENFKISTQKISDVPQFVRSMVMVKKATAQAN
GELGAVKPEIAAAIEKACDEVLLNNRCLDQFPSDVYQGGAGTSVNMNTNEVIANLALEVL
GYEKGRYDIVNPMDHVNASQSTNDAYPTGFRLAVYYSIGELLDKLTVLKNAFAAKAEEFK
DVLKMGRTQLQDAVPMTAGQEFQSFQVLLEEEILNLDRTRQLLLEVNLGATAIGTGVNTP
KGYAELVVKKLSEVSGLPCKLTENLIEATSDCGAYVMVHGALKRTAVKLSKICNDLRLLS
SGPRAGLKEINLPELQAGSSIMPAKVNPVIPEVVNQVCFKVIGNDTTITFAAEAGQLQLN
VMEPVIAQCMFETISLLGNAAVNLSDKCVKGITVNREICERYVFNSIGLVTYLNPYIGHH
NGDLVGKICAQTGKGVREVVLERGLLSEEELNRILSPENLMNPHL
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgactgtccgtatcgaacacgatttattgggcgaccgcgagattcccgccgaagtgtat
tggggcatccacaccctgcgcgccattgaaaactttaaaatctccacacaaaaaatttct
gacgtgccgcagtttgtccgcagtatggtgatggtgaaaaaggcgacggcacaggcaaac
ggtgagttgggcgcggtcaagcccgaaatcgccgccgccattgaaaaagcctgcgacgaa
gttctgctgaacaaccgctgcctcgaccaattcccgtccgacgtgtatcagggcggtgcg
ggtacttcggtcaatatgaacaccaacgaagtcatcgccaacctcgcattggaagtcttg
ggatacgaaaaaggccgctacgacatcgtcaatccgatggatcacgtcaatgccagccaa
tcgaccaacgatgcctatcccacgggcttccgccttgccgtgtattacagcatcggcgaa
ttgctcgacaaactgactgtcctgaaaaacgcctttgccgccaaagccgaagaatttaaa
gacgttttgaaaatgggccgcacccagcttcaagatgccgtgccgatgactgccggccaa
gaattccaatctttccaagtgttgttggaagaagaaatcctcaacctcgaccgcacccgc
caactgctgttggaagtcaatttgggcgcaacggcaatcggcacgggcgtgaacacgccc
aaaggctacgccgaactggtggtcaaaaaactctccgaagtcagcggcttgccttgcaaa
ctgaccgaaaacctgattgaggcgacctccgactgcggcgcatatgtgatggtacacggc
gcattgaagcgcacggcggtcaaactctccaaaatctgcaacgacttgcgcctgctctct
tccggcccgcgtgccggcttgaaagaaatcaacctgcccgaattgcaggccggttcttcc
ataatgcccgccaaagtcaatcccgtgattcccgaagtggtcaaccaagtctgcttcaaa
gtcatcggcaacgacacgacgattaccttcgccgccgaagccgggcaactgcaattaaac
gtgatggagccggtcatcgcccaatgtatgtttgaaaccatttccctcttgggcaatgcc
gcagtcaacctgtccgacaaatgcgtcaaaggcattacggtcaaccgcgaaatctgcgaa
cgttacgttttcaactccatcggtttggtgacttatctgaatccgtatatcggacaccac
aacggcgatttggtcggcaaaatctgcgcccaaaccggcaaaggcgtgcgcgaggttgtc
ttggaacgcgggctgttgagcgaagaagaactcaaccgcatcctctctcccgagaacctg
atgaacccccatctgtaa

DBGET integrated database retrieval system