KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1034Help
Entry
NMB1034           CDS       T00027                                 

Gene name
leuD
Definition
(RefSeq) isopropylmalate isomerase small subunit
  KO
K01704  3-isopropylmalate/(R)-2-methylmalate dehydratase small subunit [EC:4.2.1.33 4.2.1.35]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00290  Valine, leucine and isoleucine biosynthesis
nme00660  C5-Branched dibasic acid metabolism
nme01100  Metabolic pathways
nme01110  Biosynthesis of secondary metabolites
nme01210  2-Oxocarboxylic acid metabolism
nme01230  Biosynthesis of amino acids
Module
nme_M00432  Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Carbohydrate metabolism
   00660 C5-Branched dibasic acid metabolism
    NMB1034 (leuD)
  Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    NMB1034 (leuD)
Enzymes [BR:nme01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.33  3-isopropylmalate dehydratase
     NMB1034 (leuD)
    4.2.1.35  (R)-2-methylmalate dehydratase
     NMB1034 (leuD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aconitase_C
Motif
Other DBs
NCBI-GeneID: 903171
NCBI-ProteinID: NP_274068
UniProt: Q9JZI6
Position
complement(1049063..1049704)
Genome map
AA seq 213 aa AA seqDB search
MKAFTKITAIVAPLDRSNVDTDAIIPKQFLKSIKRSGFGPNAFDEWRYLDHGEPGMDNSK
RPLNPDFSLNQPRYQGAQILLTRKNFGCGSSREHAPWALDDYGFRAVIAPSFADIFFNNC
YKNGLLPIVLTEERVDRLFKEVEANEGYQLSIDLAEQTLTTPSGETFTFDITEHRKHCLL
NGLDEIGLTLQHADEIHAFEEKRRQSQPWLFNG
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcctttaccaaaattaccgccatcgtcgccccgctcgaccgcagcaacgtcgat
accgacgccatcatccccaaacaatttttaaaatccatcaaacgcagcggcttcggcccc
aatgcctttgacgaatggcgttacctcgaccacggcgaaccaggcatggacaacagcaaa
cgcccgttgaaccctgatttctcgctgaaccagccgcgttaccaaggcgcgcaaatcctg
ttgacgcgtaaaaacttcggttgcggctcttcacgcgaacacgccccttgggcattggac
gactacggcttccgcgccgtcatcgcccccagcttcgccgacatcttctttaacaactgc
tacaaaaacggccttttacctatcgtgttgaccgaagaacgggttgaccgacttttcaaa
gaagttgaagccaacgaaggctatcagctctccatcgaccttgccgaacaaaccctgacc
acaccaagcggcgaaacgttcacatttgacattaccgaacaccgcaaacactgcctctta
aacggcttggacgaaatcggtctgaccctgcaacacgccgacgaaattcacgcctttgaa
gaaaaacgccgccaaagccagccttggctgtttaacggttaa

DBGET integrated database retrieval system