KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1042Help
Entry
NMB1042           CDS       T00027                                 

Definition
(RefSeq) cation transporter E1-E2 family ATPase
  KO
K01533  
Cu2+-exporting ATPase [EC:3.6.3.4]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Brite
Enzymes [BR:nme01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.4  Cu2+-exporting ATPase
     NMB1042
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
1057346..1059817
Genome map
AA seq 823 aa AA seqDB search
MKKTCFHCGLDVPEHLHLTVRYENEDRETCCAGCQAVAQSIIDAGLGSYYKQRTADAQKT
ELPPQEILDQIRLYDLPEVQSDFVETHGGTREAVLMLGGITCAACVWLIEQQLLRTDGIV
RIDLNYSTHRCRVVWDDGKIRLSDILLKIRQIGYTAAPYDAQKIEAANQKERKQYIVRLA
VAGLGMMQTMMFALPTYLYGGDIEPDFLQILHWGGFLMVLPVVFYCAVPFYQGALRDLKN
RRVGMDTPITVAIIMTFIAGVYSLATNAGQGMYFESIAMLLFFLLGGRFMEHIARRKAGD
AAERLVKLIPAFCHHMPDYPDTQETCEAAVVKLKAGDIVLVKPGETIPVDGTVLEGSSAV
NESMLTGESLPVAKMPSEKVTAGTLNTQSPLIIRTDRTGGGTRLSHIVRLLDRALAQKPR
TAELAEQYASSFIFGELLLAVPVFIGWTLYADAHTALWITVALLVITCPCALSLATPTAL
AASTGTLAREGILIGGKQAIETLAQTTDIIFDKTGTLTQGKPAVRRISLLRGTDEAFVLA
VAQALEQQSEHPLARAILNCRISDGSVPDIAIKQRLNRIGEGVGAQLTVNGETQVWALGR
ASYVAEISGKEPQTEGGGSAVYLGSQSGFQAVFYLTDPLKDSAAEAVRQLAGKNLTLHIL
SGDRETAVAETARALGVAHYRAQAMPEDKLEYVKALQKEGKKVLMIGDGINDAPVLAQAD
VSAAAAGGTDIARDGADIVLLNEDLRTVAHLLDQARRTRHIIRQNLIWAGAYNIIAVPLA
VLGYVQPWIAALGMSFSSLAVLGNALRLHKRGKMQSEKMPSEQ
NT seq 2472 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaacctgtttccactgcggtctggatgttcccgaacacctccacctgactgtc
cgttacgaaaacgaagaccgcgaaacctgctgcgccggctgtcaggcggtcgcacaaagc
attattgacgcgggcttgggcagttattacaaacaacgcaccgccgacgcgcaaaaaacc
gagctgccgccccaagaaatcctcgaccaaatccgcctgtacgacctgcccgaagtccag
tccgactttgtggaaacccacggcggcacgcgcgaggcggttttaatgctcggcggcatc
acctgcgccgcctgcgtctggctgatcgaacagcagcttttgcgtacagacggcatcgtc
cgcatcgacctcaattacagcacgcaccgctgccgcgtcgtctgggacgacggcaaaatc
cgcctttccgacattctgttgaaaatcaggcagataggctacaccgccgcaccctatgac
gcgcaaaaaatcgaagccgccaaccaaaaagaacgcaaacaatacatcgtccgcctcgcc
gttgccgggctggggatgatgcagacgatgatgttcgcgctgccgacctacctttacggc
ggcgacatcgaacccgatttcctgcaaatcctccattggggcggctttttaatggtgctg
cccgtcgtattctattgcgccgtcccgttttatcaaggcgcgctgcgcgacttgaaaaac
cgccgcgtcggcatggatacgccgattaccgtcgccatcatcatgacctttatcgccggc
gtttacagccttgcgacaaatgcggggcaggggatgtatttcgaatccatcgcgatgctg
ctgtttttcctgctgggcggacgctttatggaacacattgcccgccgtaaggcaggcgat
gccgccgagaggctggtgaagctgattcctgcgttttgccatcatatgcccgattacccc
gatacgcaggaaacctgcgaggcagctgtcgtcaaattgaaagcgggcgatatcgtgctg
gtcaaaccgggcgaaaccatccccgttgacggcacggtgctggaaggaagcagtgccgtc
aacgaatctatgctgaccggcgagagcctgcccgtcgccaaaatgccgtctgaaaaagta
accgccggcacactcaacacgcaaagccccctgattatacgcaccgaccgcaccggcggt
ggcacgcgactgtcgcacatcgtccgcctgctcgaccgcgccttagcgcaaaaaccgcgc
actgccgagttggcggaacaatacgcctcgtctttcatattcggcgaactcctgcttgcc
gtccccgtcttcatcggctggacgctgtacgccgacgcgcacaccgcattgtggattacc
gtcgccctgctggtcattacctgcccctgcgccttatcgcttgccacgccgaccgcgctg
gcagcttctaccggtacgctggcgcgcgaaggtattttaatcggcggaaagcaggcaatc
gaaaccctcgcccaaaccaccgacatcatcttcgacaaaaccggcacgctgacccaaggc
aaacccgccgtccgccgtatctcattgttgagaggcacagacgaagcctttgttctcgcg
gtggcgcaggctttagaacaacagtccgaacatccccttgcccgcgccatcctcaactgc
cgcatttcagacggcagcgtccccgacatcgctattaaacaacgcctcaaccgcatcggc
gaaggcgtgggcgcgcaactgaccgtcaacggcgaaacacaggtttgggcattgggcagg
gcatcctatgtcgccgaaatttcaggtaaagaaccgcaaacagaaggcggcggcagcgcg
gtttacctcggcagtcaaagcggtttccaagccgtgttctacctgaccgaccccttgaaa
gacagcgcggcggaggcggtgcggcagttggcaggcaaaaacctgaccctgcacatcctc
agcggcgaccgcgaaaccgccgttgccgaaaccgcacgcgccctgggtgtcgcgcactac
cgcgcccaagccatgcccgaggacaaactggaatacgtcaaagccttgcaaaaagaaggg
aaaaaagtgctgatgataggcgacggcatcaacgacgcgcccgttttggcgcaggcagac
gtatccgccgccgcagcgggcgggacggatattgcgagggacggcgcggacattgtgtta
ttgaacgaagatttgcgtaccgtcgcccacctgctcgatcaggcgcggcgcacccgccat
attatccggcaaaacctgatatgggcgggcgcgtacaatatcattgccgtaccgcttgcc
gttttgggctatgtccaaccgtggatagccgcactgggtatgagcttcagttcgctggcg
gttttgggcaacgccctgcgccttcacaaacgggggaaaatgcagtctgaaaaaatgccg
tccgaacaatga

DBGET integrated database retrieval system