KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1055Help
Entry
NMB1055           CDS       T00027                                 

Gene name
glyA
Definition
(RefSeq) serine hydroxymethyltransferase
  KO
K00600  
glycine hydroxymethyltransferase [EC:2.1.2.1]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Glycine, serine and threonine metabolism
Cyanoamino acid metabolism
Glyoxylate and dicarboxylate metabolism
One carbon pool by folate
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NMB1055 (glyA)
   01230 Biosynthesis of amino acids
    NMB1055 (glyA)
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    NMB1055 (glyA)
  Energy metabolism
   00680 Methane metabolism
    NMB1055 (glyA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NMB1055 (glyA)
  Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    NMB1055 (glyA)
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    NMB1055 (glyA)
Enzymes [BR:nme01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.1  glycine hydroxymethyltransferase
     NMB1055 (glyA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(1074262..1075512)
Genome map
AA seq 416 aa AA seqDB search
MFSKSVTLAQYDPDLAAAIAQEDQRQQDHVELIASENYVSCAVMDAQGSQLTNKYAEGYP
GKRYYGGCEYVDIVEQLAIDRVKELFGAAYANVQPHSGSQANQAVYASVLKPGDTILGMS
LAHGGHLTHGASVNISGKLYNAVTYGLDENEVLDYAEVERLALEHKPKMIVAGASAYALQ
IDWAKFREIADKVGAYLFVDMAHYAGLVAGGEYPNPVPFCDFVTTTTHKTLRGPRGGVIL
CRDNTHEKALNSSIFPSLQGGPLMHVIAAKAVAFKEALQPEFKQYAKQVKINAAAMAEEL
VKRGLRIVSGRTESHVFLVDLQPMKITGKAAEAALGKAHITVNKNAIPNDPEKPFVTSGI
RIGSAAMTTRGFNEADARVLANLVADVLSNPEDEANLAKVRKQVTALCNKYPVYGA
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgttttcaaaaagcgttaccctcgcacaatacgaccccgatttggcagcagccattgcc
caagaagaccaacgccagcaagaccacgtcgagctgattgcttccgaaaactacgtcagc
tgcgccgtaatggacgcgcaaggttcccagctgaccaacaaatacgccgaaggctacccc
ggcaaacgctactacggcggctgcgaatacgtcgatattgtcgaacaattggcgattgac
cgcgtaaaagaactgtttggcgcagcctatgccaacgtccaaccgcactccggctcgcaa
gccaaccaagccgtgtacgcttccgttttaaaaccaggcgacaccattttgggtatgtct
ctagcgcacggcggccacctgacccacggcgcgagcgttaatatctcaggcaaactctac
aacgccgttacttatggtttggatgaaaacgaagtgctcgattatgccgaagtcgaacgc
ctcgcgctcgaacacaaacccaaaatgattgtggcgggtgcgtctgcctacgcgttacaa
atcgactgggcaaaattccgcgaaatcgccgataaagtcggcgcatacctctttgtcgat
atggcgcactatgccggtctggttgccggcggcgaatatcccaacccggtgccgttctgc
gacttcgtgaccaccaccacccacaaaaccctgcgcggtcctcgcggcggcgtaattttg
tgccgcgacaatacccacgaaaaagcgttgaactcttccatcttcccaagcctgcaaggc
ggtccgctgatgcacgttatcgccgccaaagccgtggcgtttaaagaagcattgcaaccc
gagttcaaacaatacgcaaaacaagtgaaaatcaatgcagccgccatggcggaagagttg
gttaaacgcggtttgcgcatcgtttccggccgcaccgaaagccacgttttcctcgttgac
ctgcaaccgatgaaaattaccggcaaagccgccgaagccgctttgggcaaagcgcacatc
accgtcaacaaaaacgccattccgaacgatccggaaaaacccttcgttacctccggcatc
cgcatcggctccgctgccatgaccacacgcggttttaacgaagccgacgcgcgcgtattg
gcgaacttggttgccgacgtattgtctaaccccgaagacgaagccaacctcgccaaagtc
cgcaaacaagtaactgctttgtgcaataaataccccgtttacggcgcgtaa

DBGET integrated database retrieval system