KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1060Help
Entry
NMB1060           CDS       T00027                                 

Gene name
fbp
Definition
(RefSeq) fructose-1,6-bisphosphatase
  KO
K03841  
fructose-1,6-bisphosphatase I [EC:3.1.3.11]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NMB1060 (fbp)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NMB1060 (fbp)
   00030 Pentose phosphate pathway
    NMB1060 (fbp)
   00051 Fructose and mannose metabolism
    NMB1060 (fbp)
  Energy metabolism
   00680 Methane metabolism
    NMB1060 (fbp)
Enzymes [BR:nme01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     NMB1060 (fbp)
Exosome [BR:nme04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NMB1060 (fbp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
complement(1078904..1079878)
Genome map
AA seq 324 aa AA seqDB search
MDTLTRFLPEHLQQNQLPEALGGVLLSVVSACTEINAKVRLGALAGVLGMAGTGNIQGED
QKKLDVIANNIMIDTLKANSAVAGLASEEEDTFVNAGENGRYLVLFDPLDGSSNIDVNIS
VGTIFSILEKPEGALATESFLQTGRQQLAAGYVLYGPQTQLVFTFGHGVYMFTLNAENEF
VLTKENPKVPESTKEFAINMSNRRHWLPPVQQYIDELLAGETGTRGKNYNMRWVASMVAE
IHRILMRGGVFMYPQDKRDPAKPGKLRLMYEANPMSLILEQAGASASNAYQAMLDIQPEN
LHQRVAVFMGSSEEVAYLDRLHAK
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atggacacactgacccgattcctccccgaacacctgcaacaaaaccagctgcccgaagca
ctcggcggcgttttactgtccgttgtttccgcctgcaccgaaatcaacgccaaagtccgc
ctcggcgcactggccggcgtattgggtatggcgggcacgggcaatattcagggcgaagac
caaaaaaaactggatgttatcgccaacaacatcatgattgacacactcaaagccaattct
gccgttgccgggctggcgagcgaggaagaagacactttcgtaaatgccggtgaaaacgga
cgctatctcgtcctattcgaccctttagacggatcgtccaatattgatgtcaacatttcc
gtcggtacgattttctccatccttgaaaaacccgaaggcgcattggcaaccgaatcattc
cttcaaacgggcagacagcagcttgccgctggttacgttctttacgggcctcaaacccag
ctcgtattcacattcggacatggcgtatatatgttcacgctcaatgccgaaaacgaattt
gtgctgaccaaagaaaacccgaaagtacccgaaagtaccaaagaatttgccatcaatatg
tccaaccgccgccactggctgccccccgtccaacaatacatcgacgagctcttggcgggc
gaaaccggtacgcgcggcaaaaactacaatatgcgctgggtagccagtatggttgccgaa
atccaccgcatcctgatgcgcggcggcgtgttcatgtatccgcaagacaaacgcgacccc
gctaaacccggcaaactgcgcctgatgtacgaagccaaccctatgagcctgatactcgaa
caggcgggcgcatcggcaagcaacgcatatcaagccatgctcgacatacagcccgaaaac
ctgcaccaacgcgtcgccgtcttcatgggcagcagcgaagaagtcgcctatctcgaccgc
ctgcacgcaaaatag

DBGET integrated database retrieval system