KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1064Help
Entry
NMB1064           CDS       T00027                                 

Definition
(RefSeq) hypothetical protein
  KO
K01515  
ADP-ribose pyrophosphatase [EC:3.6.1.13]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Purine metabolism
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    NMB1064
Enzymes [BR:nme01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.13  ADP-ribose diphosphatase
     NMB1064
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
1082094..1082630
Genome map
AA seq 178 aa AA seqDB search
MDLREVKLGGETIYEGGFVSISRDKVRLPNGNEGQRIVIRHPGAACVLAVTDEGKVVLVR
QWRYAANQATLELPAGKLDVAGEDMAACALRELAEETPYTADSVRLLYSFYTAVGFCNEK
MYLFEAEGVRLGSTLANDEDEITETVLMSKEEVRQALANDEIKDGKTLIGLQYWLMKD
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
gtggatttgagggaagtaaaattaggcggcgaaaccatttacgagggcggtttcgtcagt
atcagcagggataaggtcaggttgcccaacggcaatgaagggcagcgtatcgtcatccgc
catccgggtgcggcatgcgtgttggcggttacggacgaagggaaagtggttttggtgcgg
cagtggcgttatgcggcaaatcaggcgacattggaacttcctgcgggcaagctggatgtg
gcgggcgaggatatggcagcgtgtgcgctgcgagaattggcggaggaaacaccttatacc
gccgacagcgtacgcctgctttacagtttttatacggcggtcggtttttgcaacgaaaaa
atgtatctgttcgaagcggaaggcgtgcgtttgggcagtacgcttgccaatgacgaagac
gagattacggaaaccgtattgatgtcgaaagaagaagtccgtcaggcattggcaaacgat
gaaattaaagacggcaagacattaatcggtttgcaatactggttgatgaaggattga

DBGET integrated database retrieval system