KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1070Help
Entry
NMB1070           CDS       T00027                                 

Gene name
leuA
Definition
(RefSeq) 2-isopropylmalate synthase
  KO
K01649  
2-isopropylmalate synthase [EC:2.3.3.13]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Valine, leucine and isoleucine biosynthesis
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    NMB1070 (leuA)
  Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    NMB1070 (leuA)
Enzymes [BR:nme01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.13  2-isopropylmalate synthase
     NMB1070 (leuA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Structure
PDB: 

Jmol
Position
1090515..1092068
Genome map
AA seq 517 aa AA seqDB search
MTQTNRVIIFDTTLRDGEQSPGAAMTKEEKIRVARQLEKLGVDIIEAGFAAASPGDFEAV
NAIAKTITKSTVCSLSRAIERDIRQAGEAVAPAPKKRIHTFIATSPIHMEYKLKMKPKQV
IEAAVKAVKIAREYTDDVEFSCEDALRSEIDFLAEICGAVIEAGATTINIPDTVGYSIPY
KTEEFFRELIAKTPNGGKVVWSAHCHNDLGLAVANSLAALKGGARQVECTVNGLGERAGN
ASVEEIVMALKVRHDLFGLETGIDTTQIVPSSKLVSTITGYPVQPNKAIVGANAFSHESG
IHQDGVLKHRETYEIMSAESVGWATNRLSLGKLSGRNAFKTKLADLGIELESEEALNAAF
ARFKELADKKREIFDEDLHALVSDEMGSMNAESYKFISQKISTETGEEPRADIVFSIKGE
EKRASATGSGPVDAIFKAIESVAQSGAALQIYSVNAVTQGTESQGETSVRLARGNRVVNG
QGADTDVLVATAKAYLSALSKLEFSAAKPKAQGSGTI
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgacacagaccaaccgcgttatcattttcgacaccaccctgcgcgacggcgaacaatcg
cccggcgccgctatgaccaaagaggaaaaaatccgcgtcgcccgccagctggaaaaattg
ggtgtggacatcatcgaagcgggttttgccgctgccagcccgggcgatttcgaggcggtc
aatgcgattgcgaaaaccattaccaaatcaacggtctgttcattgtcccgcgccatcgag
cgggacatccgtcaggcgggtgaggccgttgcgcccgcgccgaaaaaacgcatccacacc
ttcatcgccaccagccccatccatatggagtacaaattgaagatgaagccgaagcaggtg
attgaggcggcggtcaaagcggtgaaaatcgctcgtgaatacaccgacgatgtggaattt
tcctgcgaagacgcgttgcgttcggaaatcgatttccttgccgaaatctgcggcgcggtg
attgaagcgggcgcgaccaccatcaatattcccgataccgtcggctattccatcccgtat
aaaaccgaagaatttttccgcgaactgattgccaaaacgcccaacggcggcaaagtcgtt
tggtcggcacactgccacaacgatttgggcttggcggttgccaattcgcttgccgcatta
aaaggcggcgcgcgtcaggtggaatgtactgtcaacggcttgggcgaacgtgcaggcaat
gcttcggttgaagaaatcgtgatggcgttgaaagtgcgccacgacttgttcggcttggaa
accggcatcgataccacgcaaatcgtgccttcgtccaaactggtgtccaccattacgggc
tatcccgtgcagcccaacaaagccattgtcggtgccaatgccttttcgcatgaatcgggc
atccatcaggacggggtgctgaaacaccgcgaaacttacgagattatgtccgccgaatcg
gtcggctgggcaacaaaccgtttgagcttgggcaaattgtccggccgcaacgccttcaaa
accaagctggcggatttgggcatcgagttggaaagcgaagaggcactgaacgcggcattt
gcacgcttcaaagaactcgccgacaaaaaacgcgaaatcttcgatgaagacctgcacgca
ctggtatccgacgaaatgggcagcatgaatgccgagagctacaaattcatctcccaaaaa
atcagcaccgaaaccggagaagaaccgcgcgccgacatcgtgttcagcatcaaaggtgaa
gaaaaacgcgcttccgcaaccggttccggccccgtggatgcgattttcaaagcgattgaa
agcgtggcgcaaagcggcgcggctttgcagatttattccgtcaacgccgtcacgcaaggt
acggaaagccagggcgaaaccagcgtccgtctggcgcgcggcaaccgcgtcgtcaacggt
cagggcgcggataccgacgttttggtcgccaccgccaaagcctacctttccgctttgagc
aagctggaatttagtgccgccaaaccgaaagcgcagggcagcggtacgatttga

DBGET integrated database retrieval system