KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1070Help
Entry
NMB1070           CDS       T00027                                 

Gene name
leuA
Definition
(RefSeq) 2-isopropylmalate synthase
  KO
K01649  
2-isopropylmalate synthase [EC:2.3.3.13]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Valine, leucine and isoleucine biosynthesis
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    NMB1070 (leuA)
   01230 Biosynthesis of amino acids
    NMB1070 (leuA)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    NMB1070 (leuA)
  Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    NMB1070 (leuA)
Enzymes [BR:nme01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.13  2-isopropylmalate synthase
     NMB1070 (leuA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Structure
PDB: 

Jmol
Position
1090515..1092068
Genome map
AA seq 517 aa AA seqDB search
MTQTNRVIIFDTTLRDGEQSPGAAMTKEEKIRVARQLEKLGVDIIEAGFAAASPGDFEAV
NAIAKTITKSTVCSLSRAIERDIRQAGEAVAPAPKKRIHTFIATSPIHMEYKLKMKPKQV
IEAAVKAVKIAREYTDDVEFSCEDALRSEIDFLAEICGAVIEAGATTINIPDTVGYSIPY
KTEEFFRELIAKTPNGGKVVWSAHCHNDLGLAVANSLAALKGGARQVECTVNGLGERAGN
ASVEEIVMALKVRHDLFGLETGIDTTQIVPSSKLVSTITGYPVQPNKAIVGANAFSHESG
IHQDGVLKHRETYEIMSAESVGWATNRLSLGKLSGRNAFKTKLADLGIELESEEALNAAF
ARFKELADKKREIFDEDLHALVSDEMGSMNAESYKFISQKISTETGEEPRADIVFSIKGE
EKRASATGSGPVDAIFKAIESVAQSGAALQIYSVNAVTQGTESQGETSVRLARGNRVVNG
QGADTDVLVATAKAYLSALSKLEFSAAKPKAQGSGTI
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgacacagaccaaccgcgttatcattttcgacaccaccctgcgcgacggcgaacaatcg
cccggcgccgctatgaccaaagaggaaaaaatccgcgtcgcccgccagctggaaaaattg
ggtgtggacatcatcgaagcgggttttgccgctgccagcccgggcgatttcgaggcggtc
aatgcgattgcgaaaaccattaccaaatcaacggtctgttcattgtcccgcgccatcgag
cgggacatccgtcaggcgggtgaggccgttgcgcccgcgccgaaaaaacgcatccacacc
ttcatcgccaccagccccatccatatggagtacaaattgaagatgaagccgaagcaggtg
attgaggcggcggtcaaagcggtgaaaatcgctcgtgaatacaccgacgatgtggaattt
tcctgcgaagacgcgttgcgttcggaaatcgatttccttgccgaaatctgcggcgcggtg
attgaagcgggcgcgaccaccatcaatattcccgataccgtcggctattccatcccgtat
aaaaccgaagaatttttccgcgaactgattgccaaaacgcccaacggcggcaaagtcgtt
tggtcggcacactgccacaacgatttgggcttggcggttgccaattcgcttgccgcatta
aaaggcggcgcgcgtcaggtggaatgtactgtcaacggcttgggcgaacgtgcaggcaat
gcttcggttgaagaaatcgtgatggcgttgaaagtgcgccacgacttgttcggcttggaa
accggcatcgataccacgcaaatcgtgccttcgtccaaactggtgtccaccattacgggc
tatcccgtgcagcccaacaaagccattgtcggtgccaatgccttttcgcatgaatcgggc
atccatcaggacggggtgctgaaacaccgcgaaacttacgagattatgtccgccgaatcg
gtcggctgggcaacaaaccgtttgagcttgggcaaattgtccggccgcaacgccttcaaa
accaagctggcggatttgggcatcgagttggaaagcgaagaggcactgaacgcggcattt
gcacgcttcaaagaactcgccgacaaaaaacgcgaaatcttcgatgaagacctgcacgca
ctggtatccgacgaaatgggcagcatgaatgccgagagctacaaattcatctcccaaaaa
atcagcaccgaaaccggagaagaaccgcgcgccgacatcgtgttcagcatcaaaggtgaa
gaaaaacgcgcttccgcaaccggttccggccccgtggatgcgattttcaaagcgattgaa
agcgtggcgcaaagcggcgcggctttgcagatttattccgtcaacgccgtcacgcaaggt
acggaaagccagggcgaaaccagcgtccgtctggcgcgcggcaaccgcgtcgtcaacggt
cagggcgcggataccgacgttttggtcgccaccgccaaagcctacctttccgctttgagc
aagctggaatttagtgccgccaaaccgaaagcgcagggcagcggtacgatttga

DBGET integrated database retrieval system