KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1151Help
Entry
NMB1151           CDS       T00027                                 

Gene name
cysI-1
Definition
(RefSeq) sulfite reductase subunit beta
  KO
K00381  
sulfite reductase (NADPH) hemoprotein beta-component [EC:1.8.1.2]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    NMB1151 (cysI-1)
Enzymes [BR:nme01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.2  assimilatory sulfite reductase (NADPH)
     NMB1151 (cysI-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(1157355..1159124)
Genome map
AA seq 589 aa AA seqDB search
MTVQTKTKGLAWQEKPLSDNERLKTESNFLRGTILDDLKDPLTGGFKGDNFQLIRFHGMY
EQDDRDIRAERAEAKLEPLKFMLLRCRLPGGIIKPSQWIELDKFARENSHYRSIRLTNRQ
TFQFHGVPKAKLQTMHRLLHKLGLDSIATAADMNRNVLCTSNPIESELHRQAYEYAKKIS
EHLLPRTRGYLDVWVDGKKVQSSDDFLQEDEPILGKTYLPRKFKTAVVIPPLNDVDCYGN
DLDFVAVSDGNGQLAGFNVLAGGGLSMEHGNTKTYPNISLELGFVPPEHALKAAEAVVTT
QRDFGNRSDRKNARTRYTIQNMGLDNFRAEVERRMGMPFEPVRPFKFTGRGDRIGWVKGI
DGNWHLTLFIESGRLVDEGGKQLLTGVLEIAKIHKGDFRITANQNLIVANVAEADKAKIE
EFARTYGLIRNDVSKLRENAMSCVSFPTCPLAMAEAERVLPDFIGELDKIMAKHGTSDDY
IVTRITGCPNGCGRAMLAEIGLVGKAVGRYNLHIGGDREGVRIPRLYKENITLPEILAEL
DDLIGKWAAERNIGEGFGDFAIRTGIVKPVLNAPVDFWDASKAVAIARA
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtacagaccaagacaaaaggtttggcgtggcaagaaaaaccgctatccgacaac
gaacgtctgaaaaccgaaagcaattttttacgcggcacgattttggacgatttgaaagac
ccgctcacgggcggcttcaaaggcgacaacttccaactcatccgcttccacggtatgtat
gagcaggacgaccgcgacatccgcgccgaacgcgccgaggcaaaactcgagcccttgaaa
tttatgcttttgcgctgccggctgccgggcgggatcatcaaaccgtcccaatggatagaa
ctggacaaatttgcccgggaaaacagtcattaccgctccatccggctgaccaaccggcaa
accttccaatttcacggcgtgccgaaagccaagttgcagacgatgcaccgcctcttgcac
aaactgggtttggattccatcgccacggcggcggatatgaaccgcaacgtgctttgcacg
tccaacccgatcgagtccgaactgcaccggcaggcttacgaatacgcgaaaaagatttcc
gaacacctgctgccgcgcacgcgcggttatctggatgtgtgggtggacggcaaaaaagtt
caaagttccgacgacttccttcaagaagacgagccgattttgggcaaaacctatctgccg
cgaaaattcaaaaccgcagtcgtcatcccgcccttgaacgatgtggactgctacggcaac
gatttggatttcgtcgccgtttcagacggtaacggacagcttgccggcttcaatgttttg
gcaggcggcgggctttcgatggaacacggcaacaccaaaacctatccgaacatttcactg
gaactgggtttcgtgcctccggaacacgcgctgaaggccgccgaagcggtggtaaccacg
cagcgcgacttcggcaaccgcagcgaccgcaaaaacgcccgcacccgctacaccattcaa
aatatgggcttggacaacttccgcgcggaagttgaacgccgtatgggtatgccgttcgaa
cccgtacgcccgttcaaatttaccgggcgcggcgaccgcatcggctgggtgaaaggcata
gacggcaactggcatttaacccttttcatcgaaagcgggcgtttggttgacgaaggcggg
aaacagcttctgaccggcgtgttggaaatcgccaaaatccacaaaggcgatttccgcatc
accgccaaccaaaacctcatcgtggcaaatgtcgccgaagcagacaaagcaaaaatcgaa
gaatttgcccgaacatacggattaatccgcaacgatgtcagcaagctgcgtgaaaatgcg
atgtcctgcgtttcctttccgacctgcccgctggcaatggcggaagccgaacgcgtgctg
ccggacttcatcggcgagctggataagattatggcgaaacacggcacgtcggacgactac
atcgttacccgcattaccggctgcccgaacggctgcggacgggcgatgttggcggaaatc
ggactggtcggcaaagccgtcggacgctacaacctccatatcggcggcgaccgtgaaggc
gtacgcatcccccgtctttacaaagaaaacatcaccctgcccgaaatccttgccgaattg
gacgacctgatcggcaaatgggcggcagaacgcaatatcggcgaaggtttcggcgatttc
gccatacggacgggcatcgtcaaacccgtattaaatgcacccgttgatttttgggacgca
tccaaagccgtcgcgattgcccgcgcctga

DBGET integrated database retrieval system