KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1177Help
Entry
NMB1177           CDS       T00027                                 

Gene name
accA-2
Definition
(RefSeq) acetyl-CoA carboxylase carboxyl transferase subunit alpha
  KO
K01962  
acetyl-CoA carboxylase carboxyl transferase subunit alpha [EC:6.4.1.2]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NMB1177 (accA-2)
   01212 Fatty acid metabolism
    NMB1177 (accA-2)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    NMB1177 (accA-2)
   00640 Propanoate metabolism
    NMB1177 (accA-2)
  Lipid metabolism
   00061 Fatty acid biosynthesis
    NMB1177 (accA-2)
Enzymes [BR:nme01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     NMB1177 (accA-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
1178969..1179928
Genome map
AA seq 319 aa AA seqDB search
MKPVFLDFEQPIAELTNKIDELRFVQDESAVDISDEIHRLQKKSNDLTKSIFSKLTPAQI
SQVSRHPQRPYTLDYIEALFTDFEELHGDRHFADDYAIVGGLARFNGQSVMVVGHQKGRD
TKEKIRRNFGMPRPEGYRKALRLMKTAEKFGLPVMTFIDTPGAYPGIGAEERGQSEAIGK
NLYELTRLRVPVLCTVIGEGGSGGALAVALGDYVNMLQYSTYSVISPEGCASILWKTAEK
AADAAQALGITADRLQKLDLVDTVIKEPLGGAHRDFGQTMKNVKAVLEKQLHEAQSIPLA
DLLSRRFDRIMAYGKFSEQ
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaacctgtttttttggattttgaacaacccatagccgaactgaccaacaaaatcgat
gagctgcgtttcgtccaagacgagtctgccgtcgatatttcggacgaaatacaccgtttg
cagaaaaaaagcaacgacctgaccaaatcgattttcagcaaactcacacccgcccaaatt
tcacaggtttcccggcatccgcagcgtccctatactttggattacattgaggcactgttt
accgattttgaagaactgcacggcgaccgccactttgccgacgattatgcgattgtcggc
ggattggcgcgtttcaacggacaaagcgtgatggtcgtcgggcatcagaaagggcgcgac
accaaagaaaaaatccgccgcaacttcggtatgccccgtcctgaaggctaccgcaaagcc
ctgcgcctgatgaagacggcagaaaaattcggcttgcccgtaatgacctttatcgatacg
ccgggcgcgtatcccggcatcggcgcggaagaacgcgggcagtcggaagccatcggcaaa
aacctgtacgaactgacgcgcctgcgcgttcctgttttgtgtaccgtcatcggcgaaggc
ggttcaggcggtgcgttggcggtcgccctaggcgattacgtcaatatgctgcaatactcg
acctattctgttatctcccccgaaggctgcgcgtctattttgtggaaaaccgccgaaaag
gcggcggatgcggctcaggctttgggcattactgctgaccgcctgcaaaagctggacttg
gtcgataccgtcatcaaagaaccattgggcggcgcgcatcgggatttcgggcaaaccatg
aaaaacgtaaaagccgttttggaaaaacaactgcacgaagcgcaaagcatcccgcttgcc
gatttgctttcgcgccgtttcgaccgcattatggcttacggcaaattttcggaacaataa

DBGET integrated database retrieval system