KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1183Help
Entry
NMB1183           CDS       T00027                                 

Gene name
mpl-2
Definition
(RefSeq) UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-meso-diaminopimelate ligase
  KO
K02558  
UDP-N-acetylmuramate: L-alanyl-gamma-D-glutamyl-meso-diaminopimelate ligase [EC:6.3.2.45]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Brite
Enzymes [BR:nme01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.45  UDP-N-acetylmuramate---L-alanyl-gamma-D-glutamyl-meso-2,6-diaminoheptanedioate ligase
     NMB1183 (mpl-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Structure
PDB: 

Jmol
Position
1183365..1184741
Genome map
AA seq 458 aa AA seqDB search
MKHIHIIGIGGTFMGGLAAIAKEAGFEVSGCDAKMYPPMSTQLEALGIDVYEGFDAAQLD
EFKADVYVIGNVAKRGMDVVEAILNLGLPYISGPQWLSENVLHHHWVLGVAGTHGKTTTA
SMLAWVLEYAGLAPGFLIGGVPENFGVSARLPQTPRQDPNSQSPFFVIEADEYDTAFFDK
RSKFVHYRPRTAVLNNLEFDHADIFADLGAIQTQFHYLVRTVPSEGLIVCNGRQQSLQDT
LDKGCWTPVEKFGTEHGWQAGEANADGSFDVLLDGKTAGRVKWDLMGRHNRMNALAVIAA
ARHVGVDIQTACEALGAFKNVKRRMEIKGTANGITVYDDFAHHPTAIETTIQGLRQRVGG
ARILAVLEPRSNTMKLGTMKSALPVSLKEADQVFCYAGGVDWDVAEALAPLGGRLNVGKD
FDAFVAEIVKNAEVGDHILVMSNGGFGGIHGKLLEALR
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgaaacacatccatattatcggtatcggcggcacgtttatgggcgggcttgccgccatt
gccaaagaagcggggtttgaagtcagcggttgcgacgcgaagatgtatccgccgatgagc
acccagctcgaagccttgggtatagacgtgtatgaaggcttcgatgccgctcagttggac
gaatttaaagccgacgtttacgttatcggcaatgtcgccaagcgcgggatggatgtggtt
gaagcgattttgaacctcggcctgccttatatttccggcccgcaatggctgtcggaaaac
gtgctgcaccatcattgggtactcggtgtggcggggacgcacggcaaaacgaccaccgcc
tccatgctcgcatgggtcttggaatatgccggcctcgcgccgggcttccttattggcggc
gtaccggaaaatttcggcgtttccgcccgcctgccgcaaacgccgcgccaagacccgaac
agccaatcgccgtttttcgtcatcgaagccgacgaatacgacaccgcctttttcgacaaa
cgttctaaattcgtgcattaccgtccgcgtaccgccgtgttgaacaatctggaattcgac
cacgccgacatctttgccgacttgggcgcgatacagacccagttccactacctcgtgcgt
accgtgccgtctgaaggcttaatcgtctgcaacggacggcagcaaagcctgcaagatact
ttggacaaaggctgctggacgccggtggaaaaattcggcacggaacacggctggcaggcc
ggcgaagccaatgccgacggctcgttcgacgtgttgctcgacggcaaaaccgccggacgc
gtcaaatgggatttgatgggcaggcacaaccgcatgaacgcgctcgccgtcattgccgcc
gcgcgtcatgtcggtgtcgatattcagaccgcctgcgaagccttgggcgcgtttaaaaac
gtcaaacgccggatggaaatcaaaggcacggcaaacggcatcaccgtttacgacgacttc
gcccaccacccgaccgccatcgaaaccacgattcaaggtttgcgccaacgcgtcggcggc
gcgcgcatcctcgccgtcctcgaaccgcgttccaacacgatgaagctgggcacgatgaag
tccgccctgcctgtaagcctcaaagaagccgaccaagtgttctgctacgccggcggcgtg
gactgggacgtcgccgaagccctcgcgcctttgggcggcaggctgaacgtcggcaaagac
ttcgatgccttcgttgccgaaatcgtgaaaaacgccgaagtaggcgaccatattttggtg
atgagcaacggcggtttcggcggaatacacggaaagctgctggaagctttgagatag

DBGET integrated database retrieval system