KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1184Help
Entry
NMB1184           CDS       T00027                                 

Gene name
bioB-2
Definition
(RefSeq) biotin synthetase
  KO
K01012  
biotin synthase [EC:2.8.1.6]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Biotin metabolism
Metabolic pathways
Module
Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    NMB1184 (bioB-2)
Enzymes [BR:nme01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.6  biotin synthase
     NMB1184 (bioB-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
1184948..1186000
Genome map
AA seq 350 aa AA seqDB search
MTVSPVALRRKTECKPHPTARYWKKCDVEALFGLPFLDLIYQAAEIHRQNFNPREIQLST
LLSIKTGGCPEDCAYCPQSAHHNTNLGKEQMMDVDEIVEKAKIAKSRGASRFCMGAAWRG
PKPKDVETVSAIIKAVKGLGMETCGTFGMLEEGMAEDLKEAGLDYYNHNLDTDPDRYNDI
IHTRQHEDRMDTLGKVRNAGLKVCCGGIVGMNETRAERAGLIASLANLDPQPESVPINRL
VKVEGTPLADAEDLDWTEFVRTIAVARITMPQSYVRLSAGRSNMPEAMQAMCFMAGANSI
FYGDKLLTTGNPDEDGDRILMEKLNLYPLQFEPEGEVAEVEKASGIKVDY
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtatcccccgtcgccttgcgccgtaagaccgagtgcaagcctcatcccaccgcg
cgctattggaaaaaatgcgatgtcgaagccctgttcggacttcccttcctcgacctcatt
taccaagccgccgaaatccaccgccaaaatttcaacccgcgcgaaatccagctttccacg
ctgttgtccatcaaaaccggcggttgtcccgaagactgcgcctattgtccgcaatcggcg
caccacaataccaatctgggcaaagagcagatgatggatgtggatgaaatcgtcgaaaaa
gccaaaatcgccaaatcgcgcggcgcaagccggttttgtatgggcgcggcgtggcgcggc
cctaaacccaaagacgtggagacggtttccgcaatcatcaaagccgtcaagggcttgggt
atggaaacctgcggcacgttcggtatgctcgaagaaggtatggcggaagacttgaaagag
gcgggcttggattattacaaccacaacctcgacaccgaccccgaccgctacaacgacatc
atccacacccgccaacacgaagaccgaatggacaccttgggcaaagtccgcaacgccggt
ttgaaagtctgctgcggcggcatcgtcgggatgaacgaaacccgcgccgaacgtgccggg
ctgattgccagtctcgccaatctcgacccgcagcccgaaagcgtgccgattaaccggttg
gtcaaagtggaaggcacgccgcttgccgatgccgaagatttggactggacggaatttgtc
cgcaccatcgccgtggcgcggattacgatgccgcaaagttatgtccggctgtcggcaggg
cgcagcaatatgcctgaagcaatgcaggcgatgtgctttatggcgggcgcgaactcgatt
ttttacggcgacaagctgctgaccacgggcaatcctgatgaggacggcgacagaatcctg
atggaaaagctcaacctgtatcccttgcagtttgaaccggaaggcgaggtcgccgaagtg
gaaaaagcctctgggattaaagtggattattga

DBGET integrated database retrieval system